KEGG   Marinithermus hydrothermalis: Marky_1223Help
Entry
Marky_1223        CDS       T01457                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marky_1223
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Marky_1223
   00630 Glyoxylate and dicarboxylate metabolism
    Marky_1223
Enzymes [BR:mhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Marky_1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1209783..1211363
Genome map
AA seq 526 aa AA seqDB search
MPEVTTSGIEVRGAPLPEAREVLTPEALAFVAALQREFGEAREALLAARAARQAALDAGE
MLDFLPETRSVREANWRVADCPEDLRDRRVEITGPAERKMMINALNSGANAFMADLEDAL
APTWGNVVRAQKNLIDAVRRRLEYTSPEGKVYRLKERLATLIVRPRGWHLEEKHVWVDGR
PVSASLFDFGLFFYHNAQALLERGSGPYFYLPKLEGHREARLWNEVFNFAQDRLGIPRGS
VRATVLIETLPAAFEMEEILYELKEHAAGLNAGRWDYIFSCIKRLRASAPLFPDRAQVTM
TVPFMRAYTELLVRTCHKRGAHAIGGMAAFVPSRKRPEVNAQAFAKVREDKEREASQGFD
GTWVAHPDLVPVAREAFDQRLGERPHQKDNLREDVRVTAQDLLDFRVPEGRITEEGLRNN
VSVALQYLNAWLSGTGAVAIHHLMEDAATAEIARAQLWQWVHRGAVLADGRAVTPALYRQ
VREEELTGLGGPEIGRYREAAEVLDRLVLNQKFHEFLTLVAYEYLE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagtgacgacgagcgggatcgaggttcgcggcgcgccccttccggaggcccgg
gaggtgctgaccccggaagccctggccttcgtggcggcgctgcagcgggagttcggcgag
gcccgcgaggccctcctcgccgcgcgcgcggcgcgccaagctgcgctcgacgctggcgaa
atgctggacttcctcccggagacccggtccgtgcgcgaggcgaactggcgggtggcggac
tgccccgaggacctgcgggaccggcgcgtggagatcaccggccccgcggaacgcaagatg
atgatcaacgccctcaactccggagcgaacgccttcatggccgacctcgaggacgccctc
gcccccacctgggggaacgtggtgcgggcccagaagaacctgatcgacgcggtgcggcgc
cggctcgagtacacgagcccggaggggaaggtgtaccggcttaaggagcggctcgcgacc
ctgatcgtccggccgcgcggctggcacctcgaggaaaagcacgtgtgggtggacgggagg
cccgtctcggccagcctgttcgatttcgggttgttcttttaccacaacgctcaagcgctc
ctggagcgaggctcgggcccgtacttctacctgccgaagctcgaggggcaccgggaggcc
cggttgtggaacgaggtgtttaacttcgcgcaggaccgcctgggcatcccgcgcggcagc
gtacgcgcgaccgtcctcatcgagacgttgcccgccgcgttcgagatggaggagatcctc
tacgagctcaaggagcacgccgcggggctgaacgccgggcgctgggactacatctttagt
tgcatcaagcgcctgcgcgccagcgcccccctcttccccgaccgcgcccaggtcacgatg
accgtgccgttcatgcgggcgtacaccgaactcttggtgcgcacctgccacaagcgcggc
gcgcacgcgatcggcggcatggcggccttcgtgcccagccgcaaacgccccgaggtgaac
gcgcaggccttcgcgaaggtccgcgaggacaaggagcgcgaggcctcccaggggttcgac
ggcacctgggtggcgcacccggacctcgtgcccgtcgctcgtgaggcgttcgaccaacgg
ttgggggaacgcccccaccaaaaggacaacctccgcgaggacgtgcgggtcacggcgcag
gacctcctcgacttccgcgtgccagagggccggatcaccgaggaaggcctgcgcaacaac
gtgagcgtggccctgcagtacctgaacgcctggctttccgggaccggcgcggtcgccatc
caccacctcatggaggacgcggccaccgccgagatcgcccgcgcgcagctgtggcagtgg
gtgcaccgcggcgcggtcctcgctgacggccgcgcggtaaccccggccctgtaccggcag
gtgcgcgaggaggagttaacgggcctcggcggcccggagatcggccggtaccgggaggcc
gcggaggtcctggaccggctggtgctgaaccagaagttccacgagttcctgacgctcgtg
gcttacgagtacctcgagtaa

DBGET integrated database retrieval system