KEGG   Marinithermus hydrothermalis: Marky_1223Help
Entry
Marky_1223        CDS       T01457                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marky_1223
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Marky_1223
   00630 Glyoxylate and dicarboxylate metabolism
    Marky_1223
Enzymes [BR:mhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Marky_1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1209783..1211363
Genome map
AA seq 526 aa AA seqDB search
MPEVTTSGIEVRGAPLPEAREVLTPEALAFVAALQREFGEAREALLAARAARQAALDAGE
MLDFLPETRSVREANWRVADCPEDLRDRRVEITGPAERKMMINALNSGANAFMADLEDAL
APTWGNVVRAQKNLIDAVRRRLEYTSPEGKVYRLKERLATLIVRPRGWHLEEKHVWVDGR
PVSASLFDFGLFFYHNAQALLERGSGPYFYLPKLEGHREARLWNEVFNFAQDRLGIPRGS
VRATVLIETLPAAFEMEEILYELKEHAAGLNAGRWDYIFSCIKRLRASAPLFPDRAQVTM
TVPFMRAYTELLVRTCHKRGAHAIGGMAAFVPSRKRPEVNAQAFAKVREDKEREASQGFD
GTWVAHPDLVPVAREAFDQRLGERPHQKDNLREDVRVTAQDLLDFRVPEGRITEEGLRNN
VSVALQYLNAWLSGTGAVAIHHLMEDAATAEIARAQLWQWVHRGAVLADGRAVTPALYRQ
VREEELTGLGGPEIGRYREAAEVLDRLVLNQKFHEFLTLVAYEYLE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagtgacgacgagcgggatcgaggttcgcggcgcgccccttccggaggcccgg
gaggtgctgaccccggaagccctggccttcgtggcggcgctgcagcgggagttcggcgag
gcccgcgaggccctcctcgccgcgcgcgcggcgcgccaagctgcgctcgacgctggcgaa
atgctggacttcctcccggagacccggtccgtgcgcgaggcgaactggcgggtggcggac
tgccccgaggacctgcgggaccggcgcgtggagatcaccggccccgcggaacgcaagatg
atgatcaacgccctcaactccggagcgaacgccttcatggccgacctcgaggacgccctc
gcccccacctgggggaacgtggtgcgggcccagaagaacctgatcgacgcggtgcggcgc
cggctcgagtacacgagcccggaggggaaggtgtaccggcttaaggagcggctcgcgacc
ctgatcgtccggccgcgcggctggcacctcgaggaaaagcacgtgtgggtggacgggagg
cccgtctcggccagcctgttcgatttcgggttgttcttttaccacaacgctcaagcgctc
ctggagcgaggctcgggcccgtacttctacctgccgaagctcgaggggcaccgggaggcc
cggttgtggaacgaggtgtttaacttcgcgcaggaccgcctgggcatcccgcgcggcagc
gtacgcgcgaccgtcctcatcgagacgttgcccgccgcgttcgagatggaggagatcctc
tacgagctcaaggagcacgccgcggggctgaacgccgggcgctgggactacatctttagt
tgcatcaagcgcctgcgcgccagcgcccccctcttccccgaccgcgcccaggtcacgatg
accgtgccgttcatgcgggcgtacaccgaactcttggtgcgcacctgccacaagcgcggc
gcgcacgcgatcggcggcatggcggccttcgtgcccagccgcaaacgccccgaggtgaac
gcgcaggccttcgcgaaggtccgcgaggacaaggagcgcgaggcctcccaggggttcgac
ggcacctgggtggcgcacccggacctcgtgcccgtcgctcgtgaggcgttcgaccaacgg
ttgggggaacgcccccaccaaaaggacaacctccgcgaggacgtgcgggtcacggcgcag
gacctcctcgacttccgcgtgccagagggccggatcaccgaggaaggcctgcgcaacaac
gtgagcgtggccctgcagtacctgaacgcctggctttccgggaccggcgcggtcgccatc
caccacctcatggaggacgcggccaccgccgagatcgcccgcgcgcagctgtggcagtgg
gtgcaccgcggcgcggtcctcgctgacggccgcgcggtaaccccggccctgtaccggcag
gtgcgcgaggaggagttaacgggcctcggcggcccggagatcggccggtaccgggaggcc
gcggaggtcctggaccggctggtgctgaaccagaagttccacgagttcctgacgctcgtg
gcttacgagtacctcgagtaa

DBGET integrated database retrieval system