KEGG   Marinithermus hydrothermalis: Marky_1224Help
Entry
Marky_1224        CDS       T01457                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marky_1224
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Marky_1224
Enzymes [BR:mhd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Marky_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1211378..1212646
Genome map
AA seq 422 aa AA seqDB search
MQEAQALARSWREDARWQGIRRTYTAEEVVRLRPSIQVEYTLARRGAERLWELMQTRPYV
HTFGALTGAQAVQMVKAGLEAIYVSGWQVAADANLAHQTYPDQSLYPANSVPTLVRRINN
ALMRADQLHRAEGQSEIDWYAPIVADAEAGFGGPLHAFELTKAMIEAGAAGVHFEDQLAA
EKKCGHLGGKVLVPTSQFIRTLQAARLAADVLGVPTVLIARTDALAATLITSDVDEYDRP
FLTGERTPEGYYRVKNGLEAAIARALAYAPYADLLWFETSTPDLEEARRFAEAIHREFPG
KLLAYNCSPSFNWRKFLGEAEIARFQKELGAMGYKFQFITLAGWHLLNYHTFDLARRYKR
EGMPAYVALQQAEFAAEEAGYTATRHQREVGTGYFDQVLLTITGGQAATAALVGSTEAEQ
FH
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaagctcaagctctggcgagatcctggcgtgaggacgcgcgctggcaaggcatc
cggcggacctacacggccgaggaggtggtgcgccttaggccctcgatccaggtggagtac
accctggcgcgccgcggggccgagcggctctgggaactcatgcagacccggccgtacgtg
cacaccttcggggccctgaccggcgcgcaggccgtgcagatggtcaaggcgggcctcgag
gcgatctacgtctcgggctggcaggtcgcggcggacgcgaacctcgcccaccagacctac
ccggaccagagcctgtacccggcgaactcggtgccgaccctggtgcggcgcatcaacaac
gccttgatgcgcgcggaccagctgcaccgcgccgaggggcaaagcgagatcgactggtac
gcgccgatcgtggcggacgctgaggcggggttcggcgggccgttgcacgccttcgagttg
acgaaggccatgatcgaggcgggcgcggccggcgtgcatttcgaggaccagctcgccgcg
gagaagaagtgcggccacctgggcggcaaggtgctcgtgcccaccagccagttcatccgc
acgctgcaggccgcgcgcctcgcggcggacgtgctcggggtgcccaccgtcctgatcgcg
cgcaccgacgcgctcgccgcgaccctcatcacctccgacgtggacgagtacgaccggccg
ttcctcacgggggaacgcaccccggaggggtactaccgcgtaaagaacggcctcgaggcg
gccatcgcccgcgccctggcgtacgcgccgtacgcggacctcctgtggttcgagaccagc
accccggacctggaagaggcccggcggttcgcggaagcgatccaccgggagttccccggg
aagctcctcgcgtataactgctcgccgtccttcaactggcggaagttcctgggagaggcg
gaaatcgcgcgcttccagaaggagctcggcgcgatggggtacaagttccagttcatcacg
ctggccggctggcacctcttgaactaccacaccttcgacctggcgcgccgctacaagcgc
gaggggatgccggcgtacgtggcgctccagcaggccgagttcgccgcggaggaagccggg
tacacggccacgcgccaccagcgcgaggtgggcaccgggtacttcgatcaggtgctgctc
accatcacgggcggccaggccgcgacggccgcgctggtgggctcgaccgaggccgagcag
ttccactaa

DBGET integrated database retrieval system