KEGG   Marinithermus hydrothermalis: Marky_1224Help
Entry
Marky_1224        CDS       T01457                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mhd01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mhd00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1211378..1212646
Genome map
AA seq 422 aa AA seqDB search
MQEAQALARSWREDARWQGIRRTYTAEEVVRLRPSIQVEYTLARRGAERLWELMQTRPYV
HTFGALTGAQAVQMVKAGLEAIYVSGWQVAADANLAHQTYPDQSLYPANSVPTLVRRINN
ALMRADQLHRAEGQSEIDWYAPIVADAEAGFGGPLHAFELTKAMIEAGAAGVHFEDQLAA
EKKCGHLGGKVLVPTSQFIRTLQAARLAADVLGVPTVLIARTDALAATLITSDVDEYDRP
FLTGERTPEGYYRVKNGLEAAIARALAYAPYADLLWFETSTPDLEEARRFAEAIHREFPG
KLLAYNCSPSFNWRKFLGEAEIARFQKELGAMGYKFQFITLAGWHLLNYHTFDLARRYKR
EGMPAYVALQQAEFAAEEAGYTATRHQREVGTGYFDQVLLTITGGQAATAALVGSTEAEQ
FH
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaagctcaagctctggcgagatcctggcgtgaggacgcgcgctggcaaggcatc
cggcggacctacacggccgaggaggtggtgcgccttaggccctcgatccaggtggagtac
accctggcgcgccgcggggccgagcggctctgggaactcatgcagacccggccgtacgtg
cacaccttcggggccctgaccggcgcgcaggccgtgcagatggtcaaggcgggcctcgag
gcgatctacgtctcgggctggcaggtcgcggcggacgcgaacctcgcccaccagacctac
ccggaccagagcctgtacccggcgaactcggtgccgaccctggtgcggcgcatcaacaac
gccttgatgcgcgcggaccagctgcaccgcgccgaggggcaaagcgagatcgactggtac
gcgccgatcgtggcggacgctgaggcggggttcggcgggccgttgcacgccttcgagttg
acgaaggccatgatcgaggcgggcgcggccggcgtgcatttcgaggaccagctcgccgcg
gagaagaagtgcggccacctgggcggcaaggtgctcgtgcccaccagccagttcatccgc
acgctgcaggccgcgcgcctcgcggcggacgtgctcggggtgcccaccgtcctgatcgcg
cgcaccgacgcgctcgccgcgaccctcatcacctccgacgtggacgagtacgaccggccg
ttcctcacgggggaacgcaccccggaggggtactaccgcgtaaagaacggcctcgaggcg
gccatcgcccgcgccctggcgtacgcgccgtacgcggacctcctgtggttcgagaccagc
accccggacctggaagaggcccggcggttcgcggaagcgatccaccgggagttccccggg
aagctcctcgcgtataactgctcgccgtccttcaactggcggaagttcctgggagaggcg
gaaatcgcgcgcttccagaaggagctcggcgcgatggggtacaagttccagttcatcacg
ctggccggctggcacctcttgaactaccacaccttcgacctggcgcgccgctacaagcgc
gaggggatgccggcgtacgtggcgctccagcaggccgagttcgccgcggaggaagccggg
tacacggccacgcgccaccagcgcgaggtgggcaccgggtacttcgatcaggtgctgctc
accatcacgggcggccaggccgcgacggccgcgctggtgggctcgaccgaggccgagcag
ttccactaa

DBGET integrated database retrieval system