KEGG   Marinithermus hydrothermalis: Marky_1278Help
Entry
Marky_1278        CDS       T01457                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00071  Fatty acid degradation
mhd00280  Valine, leucine and isoleucine degradation
mhd00281  Geraniol degradation
mhd00310  Lysine degradation
mhd00360  Phenylalanine metabolism
mhd00362  Benzoate degradation
mhd00380  Tryptophan metabolism
mhd00410  beta-Alanine metabolism
mhd00627  Aminobenzoate degradation
mhd00640  Propanoate metabolism
mhd00650  Butanoate metabolism
mhd00903  Limonene and pinene degradation
mhd01100  Metabolic pathways
mhd01110  Biosynthesis of secondary metabolites
mhd01120  Microbial metabolism in diverse environments
mhd01130  Biosynthesis of antibiotics
mhd01212  Fatty acid metabolism
Module
mhd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Marky_1278
   00650 Butanoate metabolism
    Marky_1278
  Lipid metabolism
   00071 Fatty acid degradation
    Marky_1278
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Marky_1278
   00310 Lysine degradation
    Marky_1278
   00360 Phenylalanine metabolism
    Marky_1278
   00380 Tryptophan metabolism
    Marky_1278
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Marky_1278
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Marky_1278
   00281 Geraniol degradation
    Marky_1278
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Marky_1278
   00627 Aminobenzoate degradation
    Marky_1278
   00930 Caprolactam degradation
    Marky_1278
Enzymes [BR:mhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Marky_1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEB12018
UniProt: F2NK47
Position
1273653..1274426
Genome map
AA seq 257 aa AA seqDB search
MYENLIVETLEGGVGLIRIHRPKRLNALNQATMDEIVRAVRAFEADDAVRAIVLTGDERA
FAAGADVTEMDGANVPEMLSGYRFEQWETLRRTTKPLIAAVSGFALGGGLELAMLCDIIV
ASETARLGQPEINLGIMPGAGGTQRLTRQVGKYLAMEMVLTGRMLTAEEAYRHGLVNRVV
PVEFYLEEAIQIAREIAKKAPVAVRLAKDAILKAEDTPLEVGLAYERHNFYLLFGTEDKQ
EGIRAFLEKRKPEWKGR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagaacctcatcgtggagacgctcgagggcggcgtggggctcattcgcatccac
cggcccaagcgcctcaacgccctgaaccaggccaccatggacgagatcgtccgcgcagta
cgcgcgtttgaagcggatgacgcggtgcgcgcgatcgtcctcacgggggacgagcgggcg
ttcgccgcgggcgcggacgtcaccgagatggacggcgcgaacgtgccggagatgctctcc
gggtaccgcttcgagcagtgggagaccctccggcgcaccacgaaacccttgatcgccgcg
gtctcggggttcgcgctcgggggcgggctcgagctcgcgatgctgtgcgacatcatcgta
gcctcggagaccgcgcggctcggccagcccgagatcaacctcgggatcatgccgggggcg
ggcggcacgcaacggctcacgcggcaggtgggcaagtacctcgcgatggagatggtcctc
acggggcgcatgctcaccgcggaggaggcgtaccgtcacggcctggtgaaccgggtcgtc
ccggtcgagttctacctggaggaagccatccagatcgcgcgggagatcgcgaagaaagcc
ccggtggcggtgcgcctggccaaggacgcgatcctcaaggcagaggacacgccgctcgag
gtgggcctcgcgtacgagcgccacaacttctacctgctcttcggcaccgaggacaagcaa
gaagggatccgcgctttcctcgagaagcgcaagcccgaatggaaagggaggtag

DBGET integrated database retrieval system