KEGG   Marinithermus hydrothermalis: Marky_1354Help
Entry
Marky_1354        CDS       T01457                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mhd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1360483..1361088
Genome map
AA seq 201 aa AA seqDB search
MPLSILKPVIRFLQGRLVDKREDRAVILTGGIGFEVWCPTPTLETLREGEEVALHTRLVV
REDGFTLYGFHDPVYLELFDLLTSVSGVGPRVALGMLAALPPSLLGRAVAEGDAKALTAA
PGVGKRLAERIVLELRHKIPAHLTAGGGAHRANPNAHEAIEALAALGFREAQVRTVVGTL
AAQDPEAPVEELIRRALRQLR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcccctaagtatactgaaacccgtgattcgcttccttcaaggccgactcgtggataag
cgcgaggaccgcgcggtcatcctcaccggggggatcgggttcgaggtgtggtgccccacc
ccgacgctcgaaaccctgcgcgagggggaggaggtcgcgctccacacgcggctcgtggtg
cgcgaggacgggttcacgctgtacgggtttcatgaccccgtttacctcgagctcttcgac
ctcctgacctcggtctcaggggtcggcccgcgcgtggccctcgggatgctcgcggccctc
ccccccagccttctcggccgcgcggtcgcggaaggggacgcaaaagccctcaccgcagcc
cctggggtggggaaacgcctcgcggaacggatcgtgctcgagctgcggcacaagatcccc
gcgcacctcaccgccggtgggggcgcgcaccgcgcgaacccgaacgcgcacgaggcgatc
gaggccctcgccgccctggggttccgcgaggcgcaggtccgcacggtagtaggtaccctc
gcggcacaagacccggaagcgccggtagaggagttgattcgccgggcgttgcgccagctg
cgctaa

DBGET integrated database retrieval system