KEGG   Marinithermus hydrothermalis: Marky_1370Help
Entry
Marky_1370        CDS       T01457                                 

Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marky_1370
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marky_1370
   00620 Pyruvate metabolism
    Marky_1370
   00640 Propanoate metabolism
    Marky_1370
  Energy metabolism
   00680 Methane metabolism
    Marky_1370
Enzymes [BR:mhd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Marky_1370
Lipid biosynthesis proteins [BR:mhd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Marky_1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1377249..1378832
Genome map
AA seq 527 aa AA seqDB search
MPELRLEARPRAELSARFRWEVPSAYNIGEATVDRPAARHPDRLALVEPGGRQATFREVK
DLSDRLAAWLRAQGTRPGDRVGLFLPQSLEAALAHAAVYKAGAIALPLSTLFGQDALRYR
LEHAEARLLLADRAALEPLAAAVPEGVRVVYADQLLELAAQAAPLPTPHPTRAEDPAILL
YTSGTTGRPKGALLPHRTLIGHLPGFWLYSNFPGEQAVYWSPADWAWAGGLLDVLLPAWH
HGYTVVAYRARRFDPEEALWLMERYRVTHTFLFPTALKLLRGLGRVRHNLALQSVHSGGE
PLGEELQRWSEENLGVPVNEFYGQTEANLLAGNSFRVDPIKPGSIGLPYPGHRVVLLDEE
GHPVGPGEVGEVALETPDPVAFLGYWQNPEATRAKFTGPYLRTGDLAVMDEDGYLWFKAR
KDDLIKTAGYRISPFEVEEALMQHPAVAMAAVVGAPDPERGQRIVAFVKLREGERPSEEL
TQALQAEVRRRIGRHAYPREVRYLQAFPLTPTGKIQRFKLRQHLEEA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgaggttagaggctcggccgcgcgccgagctcagcgcacgctttcgctgg
gaggtaccctccgcttacaacatcggcgaggccaccgtggaccgccccgcggcccggcac
cccgaccggctggccctcgtcgagcccggcggccgccaagccaccttccgcgaggtgaag
gacctctccgaccggttggccgcgtggctccgcgcgcagggcacgcgccccggggaccgc
gtgggccttttcctgccccagtccctcgaggcggccctcgcgcacgccgccgtgtacaag
gccggggccatcgccctgccgctctcgaccctgttcgggcaggacgccctgcgctaccgg
ctcgagcacgccgaggcccgcctccttctcgcggaccgggcggcgctcgaacctcttgca
gcggcggtgccggagggggtgcgcgtcgtgtacgccgaccagctcctggagctggccgcc
caggccgcgcccctgccgacgccccaccccacccgtgcggaggaccccgcgatcctcctg
tacacctccggcaccaccggccgccccaagggcgccttgcttccccaccgcaccctgatc
gggcaccttccaggattctggctgtactccaacttccccggggagcaggccgtctactgg
tctcccgccgactgggcctgggccggggggctgctcgacgtgcttctgcccgcgtggcac
cacgggtacacggtggtggcctaccgcgcgcggcggttcgacccggaggaggccctctgg
ttgatggagcggtaccgggtcacccacaccttcctcttccccaccgcgcttaagctgctg
cgcggcctgggccgcgtccgccacaacctcgcgctgcaaagcgtgcactcgggcggcgag
cctttgggcgaggaactgcagcgctggagcgaggaaaacctaggggtgcccgtcaacgag
ttctacggtcagaccgaggccaacctcctcgccgggaacagcttccgggtggatcccatc
aagcccgggtccatagggttgccctaccccggccaccgggtggtgctcctcgatgaggaa
ggccacccggtaggcccgggggaggtgggggaggtggccctcgagaccccggatcccgta
gccttccttgggtactggcaaaaccccgaggccacccgcgcgaagttcaccggcccgtac
ctccgcaccggggacctcgccgtgatggacgaggacgggtacctctggttcaaggcccgc
aaggacgacctgatcaagaccgccgggtaccgcatcagcccctttgaggtggaagaagcg
ctcatgcagcaccccgccgtggctatggccgcggtggtgggcgcaccggaccccgaacgc
ggccagcgcatcgtggccttcgtgaagctccgcgagggcgagcgcccctcggaagaactc
acccaggccttgcaggcagaggtgcgccgccggatcgggcgccacgcctacccccgcgag
gtccggtacctgcaagccttccccctcacccccaccgggaagatccagcgcttcaagcta
cgccagcacctcgaggaagcctaa

DBGET integrated database retrieval system