KEGG   Marinithermus hydrothermalis: Marky_1370Help
Entry
Marky_1370        CDS       T01457                                 

Definition
(GenBank) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00010  Glycolysis / Gluconeogenesis
mhd00620  Pyruvate metabolism
mhd00640  Propanoate metabolism
mhd00680  Methane metabolism
mhd01100  Metabolic pathways
mhd01110  Biosynthesis of secondary metabolites
mhd01120  Microbial metabolism in diverse environments
mhd01130  Biosynthesis of antibiotics
mhd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marky_1370
   00620 Pyruvate metabolism
    Marky_1370
   00640 Propanoate metabolism
    Marky_1370
  Energy metabolism
   00680 Methane metabolism
    Marky_1370
Enzymes [BR:mhd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Marky_1370
Lipid biosynthesis proteins [BR:mhd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Marky_1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C F-112
Motif
Other DBs
NCBI-ProteinID: AEB12105
UniProt: F2NLK6
Position
1377249..1378832
Genome map
AA seq 527 aa AA seqDB search
MPELRLEARPRAELSARFRWEVPSAYNIGEATVDRPAARHPDRLALVEPGGRQATFREVK
DLSDRLAAWLRAQGTRPGDRVGLFLPQSLEAALAHAAVYKAGAIALPLSTLFGQDALRYR
LEHAEARLLLADRAALEPLAAAVPEGVRVVYADQLLELAAQAAPLPTPHPTRAEDPAILL
YTSGTTGRPKGALLPHRTLIGHLPGFWLYSNFPGEQAVYWSPADWAWAGGLLDVLLPAWH
HGYTVVAYRARRFDPEEALWLMERYRVTHTFLFPTALKLLRGLGRVRHNLALQSVHSGGE
PLGEELQRWSEENLGVPVNEFYGQTEANLLAGNSFRVDPIKPGSIGLPYPGHRVVLLDEE
GHPVGPGEVGEVALETPDPVAFLGYWQNPEATRAKFTGPYLRTGDLAVMDEDGYLWFKAR
KDDLIKTAGYRISPFEVEEALMQHPAVAMAAVVGAPDPERGQRIVAFVKLREGERPSEEL
TQALQAEVRRRIGRHAYPREVRYLQAFPLTPTGKIQRFKLRQHLEEA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgaggttagaggctcggccgcgcgccgagctcagcgcacgctttcgctgg
gaggtaccctccgcttacaacatcggcgaggccaccgtggaccgccccgcggcccggcac
cccgaccggctggccctcgtcgagcccggcggccgccaagccaccttccgcgaggtgaag
gacctctccgaccggttggccgcgtggctccgcgcgcagggcacgcgccccggggaccgc
gtgggccttttcctgccccagtccctcgaggcggccctcgcgcacgccgccgtgtacaag
gccggggccatcgccctgccgctctcgaccctgttcgggcaggacgccctgcgctaccgg
ctcgagcacgccgaggcccgcctccttctcgcggaccgggcggcgctcgaacctcttgca
gcggcggtgccggagggggtgcgcgtcgtgtacgccgaccagctcctggagctggccgcc
caggccgcgcccctgccgacgccccaccccacccgtgcggaggaccccgcgatcctcctg
tacacctccggcaccaccggccgccccaagggcgccttgcttccccaccgcaccctgatc
gggcaccttccaggattctggctgtactccaacttccccggggagcaggccgtctactgg
tctcccgccgactgggcctgggccggggggctgctcgacgtgcttctgcccgcgtggcac
cacgggtacacggtggtggcctaccgcgcgcggcggttcgacccggaggaggccctctgg
ttgatggagcggtaccgggtcacccacaccttcctcttccccaccgcgcttaagctgctg
cgcggcctgggccgcgtccgccacaacctcgcgctgcaaagcgtgcactcgggcggcgag
cctttgggcgaggaactgcagcgctggagcgaggaaaacctaggggtgcccgtcaacgag
ttctacggtcagaccgaggccaacctcctcgccgggaacagcttccgggtggatcccatc
aagcccgggtccatagggttgccctaccccggccaccgggtggtgctcctcgatgaggaa
ggccacccggtaggcccgggggaggtgggggaggtggccctcgagaccccggatcccgta
gccttccttgggtactggcaaaaccccgaggccacccgcgcgaagttcaccggcccgtac
ctccgcaccggggacctcgccgtgatggacgaggacgggtacctctggttcaaggcccgc
aaggacgacctgatcaagaccgccgggtaccgcatcagcccctttgaggtggaagaagcg
ctcatgcagcaccccgccgtggctatggccgcggtggtgggcgcaccggaccccgaacgc
ggccagcgcatcgtggccttcgtgaagctccgcgagggcgagcgcccctcggaagaactc
acccaggccttgcaggcagaggtgcgccgccggatcgggcgccacgcctacccccgcgag
gtccggtacctgcaagccttccccctcacccccaccgggaagatccagcgcttcaagcta
cgccagcacctcgaggaagcctaa

DBGET integrated database retrieval system