KEGG   Marinithermus hydrothermalis: Marky_1375Help
Entry
Marky_1375        CDS       T01457                                 

Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marky_1375
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Marky_1375
   00640 Propanoate metabolism
    Marky_1375
   00660 C5-Branched dibasic acid metabolism
    Marky_1375
Enzymes [BR:mhd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Marky_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1383210..1384343)
Genome map
AA seq 377 aa AA seqDB search
MKLHEYQAKEILARYGVPVPPGKVAYTPEEADRIAKEFGKTVVIKAQVHVGGRGKAGGVK
LAEPHEAKEVAGRILGMNIKGLTVKKVLVAEAVDIAKEYYAGLILDRASQRVVLMVSKEG
GVDIEEVAARNPEAIIKYPIDPHKGLRPFEAREIVKRAGLEGNLNKLAAVLVQLYNAYVG
VDAFLAEINPLVVTTDGQIVAADAKIDLEDNALYRHPDLAELREVEAEHPLEIEASNYGF
AYVKLDGDVGIIGNGAGLVMYTLDLVNRAGGKPANFLDIGGGAKADVVYNAVKLVARDPD
VKGIFINIFGGITRADEVAKGVIRALEEGLLTKPVAMRVAGTAEEEAKRLLEGKPIYMYP
TSIEAAKAIVAMVGGQE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactgcacgagtatcaagccaaggagatcctggcccggtacggggtgcccgtaccg
ccgggtaaggtcgcgtacacgccggaagaggcggaccgcatcgcgaaggagttcggcaag
acggtggtcatcaaggcccaggtgcacgtgggggggcggggcaaagccggcggcgtcaag
ttagccgaaccccacgaggcgaaggaggtcgcgggccgcatcctcggcatgaacatcaag
ggcctgaccgtgaagaaggttctggtggccgaggcggtggacatcgccaaggagtactac
gccgggctcatcctggaccgcgcctcccagcgggtcgtgctcatggtctccaaggagggc
ggggtggacatcgaggaggtcgccgcccggaaccctgaggccatcatcaagtaccccatc
gatccccacaagggcctccggcccttcgaggcgcgcgagatcgtgaaacgggccggcctc
gagggtaacctgaacaagctcgccgcggtgctggtgcagctctacaacgcctacgtgggg
gtggacgccttcctcgcggagatcaaccccctcgtcgtgaccacggacgggcagatcgtt
gcggcggacgcgaagatcgacctcgaggacaacgccctgtaccgccacccggacctggcc
gagctgcgggaggtcgaggcggagcaccccctcgagatcgaggcctcgaactacgggttc
gcctacgtgaagctggacggcgacgtgggcatcatcgggaacggcgcgggcctcgtgatg
tacactctggacctggtgaaccgcgcgggtggaaagccggcgaacttcctggatatcggg
ggcggcgcgaaggccgacgtggtgtacaacgcggtgaagctcgtggcgcgcgacccggac
gtgaaagggatcttcatcaacatcttcggcggcatcacccgcgcggatgaggtggccaag
ggcgtgatccgcgcgctggaggaaggcctcttgaccaagcccgtcgcgatgcgcgtggcg
ggcaccgcggaggaggaggccaagcgcctgctggagggcaagcccatctacatgtacccg
acctcgatcgaggcggcgaaggcgatcgtggccatggtgggaggtcaggaatga

DBGET integrated database retrieval system