KEGG   Marinithermus hydrothermalis: Marky_1495Help
Entry
Marky_1495        CDS       T01457                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Marky_1495
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Marky_1495
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Marky_1495
Enzymes [BR:mhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Marky_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1511178..1512233
Genome map
AA seq 351 aa AA seqDB search
MPRPLIERFRERLPVSERTPIVSLLEGSTPLIPLKGPPEARQRGVQLYAKYEGLNPTGSF
KDRGMTLAVSKALEAGAQAVACASTGNTSASAAAYAARAGVRAIVVLPAGYVALGKVAQT
LVHGARIVQIEGNFDAALRLVRALSEAYPVALVNSVNPYRLEGQKTLAFEVVEALGEAPE
YHALPVGNAGNITAHWMGYSELFTDGVIGKRPRMLGFQAAGAAPIVQGRPVEAPETIASA
IRIGNPASWQGALRARDESGGAVEAVTDEEILAAYRYLAAEEGIFCEPASAAALAGVWRW
LRAGRIDPGARVVLTLTGHGLKDPGTAERLARLPEPVPATLEAVARAAGLE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccccgaccgttgatcgaacgcttccgtgaacgcctccccgtgagcgaacgcaccccg
atcgtctcgctcctcgagggctccacccccctcatccccctcaagggtccccctgaggcc
cgtcagcgcggcgtgcagctttacgccaagtacgagggcctgaaccccaccggctcgttc
aaggaccgcggcatgaccctggcggtgagcaaagccctcgaggctggcgcgcaggcggtg
gcctgcgcctccaccgggaacacctcggcttcggccgcggcctacgccgcgcgggccgga
gtgcgcgcgatcgtggtgctgcccgcggggtacgtggccctagggaaggtcgcgcaaacg
ctggtgcacggcgcgcggatcgtccagatcgaggggaattttgacgccgcgctgcggcta
gtgcgcgcgctgagcgaggcctacccggtcgccctcgtaaactcggtgaacccctaccgg
ctcgaggggcagaaaaccctggccttcgaggtggttgaggcgctgggggaggcccccgag
taccacgccctgcccgtggggaacgcgggcaacatcaccgcgcactggatggggtacagc
gagctcttcacggacggtgtgatcggaaagcgcccccggatgctgggcttccaggcggcc
ggcgccgcgcccatcgtacagggtcggcccgtcgaggcccctgagacgattgcaagcgcg
attcgcatcgggaaccccgcgagctggcagggtgcgctgcgcgcgcgggacgagtccggc
ggcgcggtcgaggccgtgaccgacgaggagattctggccgcctaccggtacctcgccgcg
gaggaagggatcttctgcgagcccgcctcggccgcagccctcgcgggggtgtggcgctgg
ctgcgcgcgggccggatcgatccgggcgctcgcgtggtcctgaccctcaccggtcacggc
ctcaaggaccccggcaccgcggaacgcctggcccgcctgcccgaaccggtgcccgcgacc
ctcgaggccgtggcgcgcgcggcggggctcgagtag

DBGET integrated database retrieval system