KEGG   Marinithermus hydrothermalis: Marky_1495Help
Entry
Marky_1495        CDS       T01457                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00260  Glycine, serine and threonine metabolism
mhd00750  Vitamin B6 metabolism
mhd01100  Metabolic pathways
mhd01110  Biosynthesis of secondary metabolites
mhd01120  Microbial metabolism in diverse environments
mhd01230  Biosynthesis of amino acids
Module
mhd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Marky_1495
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Marky_1495
Enzymes [BR:mhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Marky_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEB12230
UniProt: F2NPE9
Position
1511178..1512233
Genome map
AA seq 351 aa AA seqDB search
MPRPLIERFRERLPVSERTPIVSLLEGSTPLIPLKGPPEARQRGVQLYAKYEGLNPTGSF
KDRGMTLAVSKALEAGAQAVACASTGNTSASAAAYAARAGVRAIVVLPAGYVALGKVAQT
LVHGARIVQIEGNFDAALRLVRALSEAYPVALVNSVNPYRLEGQKTLAFEVVEALGEAPE
YHALPVGNAGNITAHWMGYSELFTDGVIGKRPRMLGFQAAGAAPIVQGRPVEAPETIASA
IRIGNPASWQGALRARDESGGAVEAVTDEEILAAYRYLAAEEGIFCEPASAAALAGVWRW
LRAGRIDPGARVVLTLTGHGLKDPGTAERLARLPEPVPATLEAVARAAGLE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccccgaccgttgatcgaacgcttccgtgaacgcctccccgtgagcgaacgcaccccg
atcgtctcgctcctcgagggctccacccccctcatccccctcaagggtccccctgaggcc
cgtcagcgcggcgtgcagctttacgccaagtacgagggcctgaaccccaccggctcgttc
aaggaccgcggcatgaccctggcggtgagcaaagccctcgaggctggcgcgcaggcggtg
gcctgcgcctccaccgggaacacctcggcttcggccgcggcctacgccgcgcgggccgga
gtgcgcgcgatcgtggtgctgcccgcggggtacgtggccctagggaaggtcgcgcaaacg
ctggtgcacggcgcgcggatcgtccagatcgaggggaattttgacgccgcgctgcggcta
gtgcgcgcgctgagcgaggcctacccggtcgccctcgtaaactcggtgaacccctaccgg
ctcgaggggcagaaaaccctggccttcgaggtggttgaggcgctgggggaggcccccgag
taccacgccctgcccgtggggaacgcgggcaacatcaccgcgcactggatggggtacagc
gagctcttcacggacggtgtgatcggaaagcgcccccggatgctgggcttccaggcggcc
ggcgccgcgcccatcgtacagggtcggcccgtcgaggcccctgagacgattgcaagcgcg
attcgcatcgggaaccccgcgagctggcagggtgcgctgcgcgcgcgggacgagtccggc
ggcgcggtcgaggccgtgaccgacgaggagattctggccgcctaccggtacctcgccgcg
gaggaagggatcttctgcgagcccgcctcggccgcagccctcgcgggggtgtggcgctgg
ctgcgcgcgggccggatcgatccgggcgctcgcgtggtcctgaccctcaccggtcacggc
ctcaaggaccccggcaccgcggaacgcctggcccgcctgcccgaaccggtgcccgcgacc
ctcgaggccgtggcgcgcgcggcggggctcgagtag

DBGET integrated database retrieval system