KEGG   Marinithermus hydrothermalis: Marky_1495Help
Entry
Marky_1495        CDS       T01457                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Marky_1495
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Marky_1495
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Marky_1495
Enzymes [BR:mhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Marky_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1511178..1512233
Genome map
AA seq 351 aa AA seqDB search
MPRPLIERFRERLPVSERTPIVSLLEGSTPLIPLKGPPEARQRGVQLYAKYEGLNPTGSF
KDRGMTLAVSKALEAGAQAVACASTGNTSASAAAYAARAGVRAIVVLPAGYVALGKVAQT
LVHGARIVQIEGNFDAALRLVRALSEAYPVALVNSVNPYRLEGQKTLAFEVVEALGEAPE
YHALPVGNAGNITAHWMGYSELFTDGVIGKRPRMLGFQAAGAAPIVQGRPVEAPETIASA
IRIGNPASWQGALRARDESGGAVEAVTDEEILAAYRYLAAEEGIFCEPASAAALAGVWRW
LRAGRIDPGARVVLTLTGHGLKDPGTAERLARLPEPVPATLEAVARAAGLE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccccgaccgttgatcgaacgcttccgtgaacgcctccccgtgagcgaacgcaccccg
atcgtctcgctcctcgagggctccacccccctcatccccctcaagggtccccctgaggcc
cgtcagcgcggcgtgcagctttacgccaagtacgagggcctgaaccccaccggctcgttc
aaggaccgcggcatgaccctggcggtgagcaaagccctcgaggctggcgcgcaggcggtg
gcctgcgcctccaccgggaacacctcggcttcggccgcggcctacgccgcgcgggccgga
gtgcgcgcgatcgtggtgctgcccgcggggtacgtggccctagggaaggtcgcgcaaacg
ctggtgcacggcgcgcggatcgtccagatcgaggggaattttgacgccgcgctgcggcta
gtgcgcgcgctgagcgaggcctacccggtcgccctcgtaaactcggtgaacccctaccgg
ctcgaggggcagaaaaccctggccttcgaggtggttgaggcgctgggggaggcccccgag
taccacgccctgcccgtggggaacgcgggcaacatcaccgcgcactggatggggtacagc
gagctcttcacggacggtgtgatcggaaagcgcccccggatgctgggcttccaggcggcc
ggcgccgcgcccatcgtacagggtcggcccgtcgaggcccctgagacgattgcaagcgcg
attcgcatcgggaaccccgcgagctggcagggtgcgctgcgcgcgcgggacgagtccggc
ggcgcggtcgaggccgtgaccgacgaggagattctggccgcctaccggtacctcgccgcg
gaggaagggatcttctgcgagcccgcctcggccgcagccctcgcgggggtgtggcgctgg
ctgcgcgcgggccggatcgatccgggcgctcgcgtggtcctgaccctcaccggtcacggc
ctcaaggaccccggcaccgcggaacgcctggcccgcctgcccgaaccggtgcccgcgacc
ctcgaggccgtggcgcgcgcggcggggctcgagtag

DBGET integrated database retrieval system