KEGG   Marinithermus hydrothermalis: Marky_1617Help
Entry
Marky_1617        CDS       T01457                                 

Definition
succinate dehydrogenase cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mhd  Marinithermus hydrothermalis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marky_1617
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Marky_1617
   00650 Butanoate metabolism
    Marky_1617
  Energy metabolism
   00190 Oxidative phosphorylation
    Marky_1617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1630769..1631164)
Genome map
AA seq 131 aa AA seqDB search
MAIRARRYEDAKQQAGTNLELAWWVFMRISGLLLVFLALGHLYIQNILINAGEIDYDYVA
KRLSQTTWKVYDWLLLALALLHGTNGMRYVIDDLVRNPAVRFWVKTVFYTVVAILFFLGS
LVLFNYDFQIS
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcgattcgagcgcggcgctacgaggacgcgaagcagcaggccggcacgaacctcgag
ctggcctggtgggtgttcatgcggatatcgggcctcttgctcgttttcttggccctggga
cacctgtacatccaaaacatcctgatcaacgcgggagagatcgattacgactacgtggcg
aagcggctgagccagaccacctggaaggtgtacgactggttgctcctcgcgctggcgttg
ctgcacggtacgaacggtatgcggtacgtgatcgacgacctggtgcggaacccggccgtg
cgtttttgggtgaagacggtgttctacacggtggtggcgatcctgttcttcctggggagc
ctggtgctcttcaattacgacttccagatttcgtaa

DBGET integrated database retrieval system