KEGG   Marinithermus hydrothermalis: Marky_1624Help
Entry
Marky_1624        CDS       T01457                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00230  Purine metabolism
mhd01100  Metabolic pathways
Module
mhd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Marky_1624
Enzymes [BR:mhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Marky_1624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 RsgA_GTPase Sugarporin_N
Motif
Other DBs
NCBI-ProteinID: AEB12359
UniProt: F2NKB0
Position
complement(1634950..1635612)
Genome map
AA seq 220 aa AA seqDB search
MAMARGNLFVMTGASGVGKGTIRARLMERVAFHYSISMTTRPPREGERHGVDYWFVTPEE
FEAEIERGGLLEWCRYVDHYYGTPREPVERALARGEDVLLEIEVQGALQVAQQVPEAVLI
FVVPPSLSELRSRLLRRGKDSLEKIEKRLKRAEEELEQAEAFHYVVVNDLLEQAVTAIEH
IVWAERSKSARMRHAIERAKARDPLLEAELDRITRKLKED
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctatggcgagaggcaacctgttcgtgatgaccggagcttcaggggtgggcaaaggc
accatccgcgcccgcctcatggagcgcgtcgccttccactactcgatctccatgacgacc
cgcccgccccgcgaaggagagcggcacggggtggactactggttcgtcacccccgaggag
ttcgaggccgagatcgagcgcggcggcctgctcgagtggtgccggtacgtggaccactac
tacggcaccccccgcgaacccgtggagcgggccttggcgcgcggggaggacgtcctcctg
gagatcgaggtgcagggggcgttgcaggtggcccagcaggtgccggaagcggtcctgatc
ttcgtggtgccgccctccctcagcgagctgcgcagccgcctcctccggcgcggcaaggac
tccctagaaaagatcgagaaacgcctcaaacgcgcagaagaggagctcgagcaggccgag
gccttccactatgtggtggtgaacgacctgctcgaacaggccgtaacggccatcgagcat
atcgtgtgggccgagcggagcaagagcgcgcgcatgcggcacgccatcgagcgcgccaag
gcccgcgacccgctgttggaagccgaactggatcgaatcacccgcaagctcaaggaggat
tga

DBGET integrated database retrieval system