KEGG   Marinithermus hydrothermalis: Marky_1785Help
Entry
Marky_1785        CDS       T01457                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marky_1785
   01230 Biosynthesis of amino acids
    Marky_1785
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marky_1785
   00030 Pentose phosphate pathway
    Marky_1785
   00051 Fructose and mannose metabolism
    Marky_1785
   00052 Galactose metabolism
    Marky_1785
  Energy metabolism
   00680 Methane metabolism
    Marky_1785
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Marky_1785
Enzymes [BR:mhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Marky_1785
Protein phosphatases and associated proteins [BR:mhd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Marky_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1778934..1779902)
Genome map
AA seq 322 aa AA seqDB search
MKRIGVLTSGGDAPGMNAAIRAVVRVAHTQGVEVVGIRRGYAGMIEGEFQPLGPRDVANI
IQRGGTILLTARSKAFMTREGRAQAAAHLKNAGIDGLVVIGGDGTFHGAIKLIKEHQIPV
VGVPGTIDNDLYGTDYTIGFDTAVNTALEAIDRIRDTAASHGRVFFIEVMGRDAGFIALD
VGIAGGAEIIALPEISVSPQEIAEVITRSAEKGKQSSIVVVAEGAYPGGAEALMRAVAEL
TGLEGRVTVLGHIQRGGSPTAKDRVLASRLGGAAAEALIGGASGVMLGEVEGEVALTPLH
EAVGNRKDIRRELYELARVLAV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggatcggggtgttgaccagcgggggagacgcccccggcatgaacgcggccata
cgggccgtggtgcgcgtagcgcacacccagggcgtcgaggtcgtggggatccgccgtggg
tacgcaggcatgatcgagggagagttccagccgctcgggccgcgcgacgtcgccaacatc
atccagcggggcggcacgatcctcctcaccgcgcgcagcaaggccttcatgacgcgggaa
ggacgagcccaggccgcggcgcacctcaagaacgcgggcatcgacggcctcgtcgtgatc
ggaggagacggcaccttccacggcgcgatcaagctgatcaaggagcaccagatccccgta
gtgggggtgcccggcacgatcgacaacgacctgtacgggaccgactacacgatcgggttc
gacactgcggtgaacaccgccctcgaggccatcgaccggattcgcgacaccgccgcgagc
cacgggcgcgtcttcttcatcgaggtgatggggcgggacgcggggttcatcgccctcgac
gtggggatcgccggcggtgcggagatcatcgcgctgccggagatcagcgtgagcccgcag
gagatcgccgaggtgatcacgcgctccgcggaaaaaggcaagcagtcctcgatcgtggtg
gtggccgaaggcgcgtaccccggaggggccgaggccctgatgcgcgcggtggcggaactc
accggtctcgaggggcgcgttacggtgctcggccacatccagcggggcggcagccccacg
gcgaaggaccgggtcctggcgagccgcttgggcggcgcggccgccgaggccctgatcggc
ggggcgagcggtgtgatgctaggcgaggtggagggggaggtggccctaacgccgctgcac
gaggccgtagggaaccgcaaggacatccggcgcgagttgtacgagctcgcgcgggtcctg
gccgtgtaa

DBGET integrated database retrieval system