KEGG   Marinithermus hydrothermalis: Marky_1792Help
Entry
Marky_1792        CDS       T01457                                 

Definition
N-acylmannosamine kinase (EC:2.7.1.60)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marky_1792
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marky_1792
   00052 Galactose metabolism
    Marky_1792
   00500 Starch and sucrose metabolism
    Marky_1792
   00520 Amino sugar and nucleotide sugar metabolism
    Marky_1792
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Marky_1792
   00524 Butirosin and neomycin biosynthesis
    Marky_1792
Enzymes [BR:mhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Marky_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1784526..1785422)
Genome map
AA seq 298 aa AA seqDB search
MATVGVDLGGTKIAAGVLADGRVRARTVRPTPKEGGLAVVEAMAACVRAAIQESGLSGVK
AVGVGSPGPLDFERGRVRFAPNIPNLTDFPLREALAEAVGLPVVLENDANAAALAEHHLG
AAKDAQSSVYVTVSTGIGGGVVFGDRVWRGAFGQGGEVGHFVVLPHGPVCGCGQSGCLEA
LASGVAIARDARYAYKREMDTPEVFARWRKGEPKARRIVEQAADYLGLGLASLQRVLDPE
VFVLGGGVVLGGGAAYLELVQAAFARYTEGWRAGALRVAALGKEAGWIGAALAAELSG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggtaggggtggacctgggcggcaccaagatcgctgcgggtgttttggcggac
gggcgggtgcgcgcgcggaccgtgcggcccacccctaaggagggcgggctggccgtggtg
gaggcgatggcggcgtgcgtgcgcgccgcgatccaggaaagcggcctctccggcgtgaag
gccgtgggggtcggctcgcccgggccgttggattttgagcgcggccgggtgcggttcgcg
ccgaacatcccgaacctcacggacttccccttgagggaggcgctcgccgaggcggtgggg
ctgccggtggtgctggagaacgacgcgaacgccgcggcgctcgcggagcaccacctgggc
gcggcgaaggacgcgcaaagctcggtgtacgtcacggtctcgaccggaatcgggggcggc
gtggtttttggggaccgggtctggcgcggcgcgttcgggcaggggggggaggtcgggcat
ttcgtcgtgctgccgcacggcccggtctgcggttgcggccagtccggctgcctcgaggcc
ctcgcctcgggcgtggcgatcgcgcgggacgcgcgctacgcctacaagcgagagatggac
acccccgaggtgttcgcgcgctggcgaaaaggcgagcccaaagcccggcggatcgtggag
caagccgcggactacctggggctggggctggcctccctgcagcgggtgctggaccccgag
gtgttcgtgctggggggcggcgtggtgctcgggggcggggcggcctacctcgagctcgtg
caggccgcgttcgcgcgctacaccgagggctggcgggcgggcgcgctgcgcgtcgcggcg
ctcggcaaggaggccggctggatcggggcggccttggccgcggagctctcggggtga

DBGET integrated database retrieval system