KEGG   Marinithermus hydrothermalis: Marky_1856Help
Entry
Marky_1856        CDS       T01457                                 

Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marky_1856
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Marky_1856
  Amino acid metabolism
   00310 Lysine degradation
    Marky_1856
Enzymes [BR:mhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Marky_1856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1861024..1862292
Genome map
AA seq 422 aa AA seqDB search
MAIEIRVPEAGESIVEVEVGEWLKAEGERVEKDEPIVELVTDKATMELPAPAAGVLGKVL
KPSGALVKVGEVIAYLETEGAAAAPKAPVQEPAAAQPQPEAAREEVPVAPAARRLMAEHG
LSPRDVKGSGPGGRILKEDVLRAIEAKKARPSAPEPAPAPAPTPQPAPAPRQAPPPPPAP
AAPAGYDAPWRYEEAVPMSPLRRRIAQRLVEAQQTMAMLTTFNEADMSAVLALRRELGER
FKEKYGVKLGIMSFFVKAVIQALKEIPELNAEIRDNHIIYKRYYDIGIAIGVGEALVVPV
LRDADRMSFADIERAIADFAERARAKKLRPEELQGGTFSITNGGVFGSLNSTPIINPPQV
GILGMHAIQERPVGRNGEIVLRPMMNLALSYDHRIVDGREAVTFLRRVKECIENPARLLI
EV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatccgggtacccgaagcgggtgagtcgatcgttgaggtcgaggtcggc
gagtggttgaaggccgagggcgagcgggtggagaaggacgagccgatcgtggagctcgtc
acggacaaggccacgatggagctgccggctccggccgcgggggtgctgggcaaggtgctc
aagcccagcggcgcgctggtcaaggtgggcgaggtgatcgcgtacctggagaccgagggg
gcggccgcggccccgaaggcgcccgttcaggagccggccgccgcgcagccgcaaccggag
gccgcgcgggaggaggtgcccgtcgcgccggcggcgcgccgcttgatggccgagcacggc
ctttcgccgcgggacgttaaggggagcgggcctggcgggcgcatcctgaaggaggacgtg
ctgcgcgccatcgaggcgaagaaggcccggccttcggcccctgagccggccccggcgccc
gcgccgaccccccagccggcccccgcgccgcgccaagccccgcccccaccgcccgccccg
gcggcccccgcggggtacgacgcgccttggcggtacgaggaggccgtgccgatgagcccg
ctccgccgccgcatcgcgcagcgcctcgtggaggcccagcagaccatggcgatgctcacg
accttcaacgaggcggacatgtccgcggtgctggcgctcaggcgcgagctcggggagcgc
ttcaaggagaagtacggcgtgaagctcgggatcatgagcttcttcgtgaaggccgtgatc
caggcgctcaaggagatccccgagctgaacgcggagatccgcgacaaccacatcatctac
aagcgctactacgatatcggcatcgcgatcggcgtgggggaggcgctcgtggtgccggta
ttgcgggacgcggaccgcatgagcttcgcggacatcgagcgagcgatcgcggacttcgcg
gagcgcgcgcgggcgaagaagctccgcccggaggagttgcagggcggcaccttctccatc
acgaacggcggggtgttcggctcgctgaactccaccccgatcatcaatcccccgcaggtg
gggatcctgggcatgcacgcgatccaggagcggccggtcggccggaacggggagatcgtg
ctgcgccccatgatgaacctcgcgctctcctacgaccaccgcatcgtggacggccgcgag
gcggtcaccttcctgcggcgcgtgaaggagtgcatcgagaacccggcgcgtctcctcatc
gaggtgtaa

DBGET integrated database retrieval system