KEGG   Marinithermus hydrothermalis: Marky_1856Help
Entry
Marky_1856        CDS       T01457                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00020  Citrate cycle (TCA cycle)
mhd00310  Lysine degradation
mhd01100  Metabolic pathways
mhd01110  Biosynthesis of secondary metabolites
mhd01120  Microbial metabolism in diverse environments
mhd01130  Biosynthesis of antibiotics
mhd01200  Carbon metabolism
Module
mhd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mhd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Marky_1856
  Amino acid metabolism
   00310 Lysine degradation
    Marky_1856
Enzymes [BR:mhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Marky_1856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AEB12587
UniProt: F2NR09
Position
1861024..1862292
Genome map
AA seq 422 aa AA seqDB search
MAIEIRVPEAGESIVEVEVGEWLKAEGERVEKDEPIVELVTDKATMELPAPAAGVLGKVL
KPSGALVKVGEVIAYLETEGAAAAPKAPVQEPAAAQPQPEAAREEVPVAPAARRLMAEHG
LSPRDVKGSGPGGRILKEDVLRAIEAKKARPSAPEPAPAPAPTPQPAPAPRQAPPPPPAP
AAPAGYDAPWRYEEAVPMSPLRRRIAQRLVEAQQTMAMLTTFNEADMSAVLALRRELGER
FKEKYGVKLGIMSFFVKAVIQALKEIPELNAEIRDNHIIYKRYYDIGIAIGVGEALVVPV
LRDADRMSFADIERAIADFAERARAKKLRPEELQGGTFSITNGGVFGSLNSTPIINPPQV
GILGMHAIQERPVGRNGEIVLRPMMNLALSYDHRIVDGREAVTFLRRVKECIENPARLLI
EV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatccgggtacccgaagcgggtgagtcgatcgttgaggtcgaggtcggc
gagtggttgaaggccgagggcgagcgggtggagaaggacgagccgatcgtggagctcgtc
acggacaaggccacgatggagctgccggctccggccgcgggggtgctgggcaaggtgctc
aagcccagcggcgcgctggtcaaggtgggcgaggtgatcgcgtacctggagaccgagggg
gcggccgcggccccgaaggcgcccgttcaggagccggccgccgcgcagccgcaaccggag
gccgcgcgggaggaggtgcccgtcgcgccggcggcgcgccgcttgatggccgagcacggc
ctttcgccgcgggacgttaaggggagcgggcctggcgggcgcatcctgaaggaggacgtg
ctgcgcgccatcgaggcgaagaaggcccggccttcggcccctgagccggccccggcgccc
gcgccgaccccccagccggcccccgcgccgcgccaagccccgcccccaccgcccgccccg
gcggcccccgcggggtacgacgcgccttggcggtacgaggaggccgtgccgatgagcccg
ctccgccgccgcatcgcgcagcgcctcgtggaggcccagcagaccatggcgatgctcacg
accttcaacgaggcggacatgtccgcggtgctggcgctcaggcgcgagctcggggagcgc
ttcaaggagaagtacggcgtgaagctcgggatcatgagcttcttcgtgaaggccgtgatc
caggcgctcaaggagatccccgagctgaacgcggagatccgcgacaaccacatcatctac
aagcgctactacgatatcggcatcgcgatcggcgtgggggaggcgctcgtggtgccggta
ttgcgggacgcggaccgcatgagcttcgcggacatcgagcgagcgatcgcggacttcgcg
gagcgcgcgcgggcgaagaagctccgcccggaggagttgcagggcggcaccttctccatc
acgaacggcggggtgttcggctcgctgaactccaccccgatcatcaatcccccgcaggtg
gggatcctgggcatgcacgcgatccaggagcggccggtcggccggaacggggagatcgtg
ctgcgccccatgatgaacctcgcgctctcctacgaccaccgcatcgtggacggccgcgag
gcggtcaccttcctgcggcgcgtgaaggagtgcatcgagaacccggcgcgtctcctcatc
gaggtgtaa

DBGET integrated database retrieval system