KEGG   Marinithermus hydrothermalis: Marky_1933Help
Entry
Marky_1933        CDS       T01457                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mhd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1940398..1941807
Genome map
AA seq 469 aa AA seqDB search
MKPQTLGELKRAYPLEKLRRSVKDEARENLIAKLRRGDPLFPGIHGYEETVVPHLVNAIL
ARHNFILLGLRGQAKSRLLRALIDLLDPEIPALPTEIRDNPLHPLSAEGRRLLAEAGDDA
PIVWVPADERYVEKLATPDTTVADLIGDVDPIKAARRGTGLGDLEAVHYGLLPRANRGIF
AVNELADLAPKVQVALFNILQEGDVQIKGYPVRLPLDVWLVFTANPQDYTARGKIVTPLK
DRIGSEIRTHYPRTLEEGLKITLQEAWTEREESLLVPPFVAAGVEAVAFAAREDKRVDQT
SGVSQRVSISLLELVASNAERRAIRYGERPVARPLDVYFGLPAVTGKLELEYEGELVGAE
RIARELVLKAFGQAFGAYARSLPTDEVVAWFEEGNLLRLPEGPARAVVEAMGPVPGLVAA
ARSLAGSDQPELLAAAGEFVLEGLAGRRKIARGEETYSAALGEHPQWGN
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccccaaaccctgggcgagctgaagcgcgcctaccccctggagaagctgcggcgg
agcgtgaaggacgaggcgcgggagaacctgatcgccaagctccggcggggcgacccgctc
tttcccgggattcacgggtacgaggagaccgtcgtcccgcacctggtgaacgcgatcctc
gcgcggcacaacttcatcctgctcgggcttcggggccaggcgaaaagccgcctcttgcgc
gcgctgatcgacctcctggaccccgagatcccggcgctgcccaccgagatccgcgacaac
cccctccaccccctctccgccgagggccggcgcctcctggccgaagcgggggacgacgcg
ccgatcgtctgggtgcccgcggacgagcggtacgtggagaagctcgccacgcccgacacc
accgtcgcggacctgatcggggacgtggaccccatcaaggccgcgcggcgcggcacgggc
ctcggcgacctcgaggccgtgcactacggcctgctgccccgcgcgaaccgcgggatcttc
gcggtgaacgagctcgcggacctcgcccccaaggtgcaggtggccctcttcaacatcctc
caggagggggacgtacagatcaaagggtaccccgtgcgcctcccgctcgacgtgtggctg
gtcttcaccgccaatccccaggactataccgcgcgcggcaagatcgtcacgccgctcaag
gaccggatcggctccgagatccgcacgcactacccgcgcaccctcgaggaggggttgaag
atcacgctgcaggaagcctggaccgagcgggaggagagccttctcgtaccgccgttcgtt
gcggccggggtggaggccgtggccttcgcggcccgcgaggacaaacgcgtggatcaaacc
agcggggtttcgcagcgcgtcagcatcagcctgctcgagctcgtggcctcgaacgccgag
cggcgcgccatccggtacggggagcggcccgtcgctcgtccgctcgacgtgtacttcggc
ctgcccgcggtgacgggcaagctcgagctggagtacgagggggagctggtgggcgcggaa
cgcatcgcgcgggagctggttctgaaggcgttcgggcaggctttcggcgcgtacgcgcgc
agcctgccaacggacgaggtggtggcgtggttcgaggagggcaacctcctccggctcccg
gaaggccccgcgcgtgcggtggtggaggcgatggggccggtcccgggccttgtggccgcg
gcgcgaagcctcgcggggtccgaccagccggagctgctcgccgcggcgggagagttcgtg
ctggaggggctcgctggccgcaggaagatcgcgcgcggcgaggaaacctacagcgccgcg
ctgggcgaacacccccagtgggggaactag

DBGET integrated database retrieval system