KEGG   Marinithermus hydrothermalis: Marky_2087Help
Entry
Marky_2087        CDS       T01457                                 

Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Marky_2087
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Marky_2087
   00650 Butanoate metabolism
    Marky_2087
  Lipid metabolism
   00071 Fatty acid degradation
    Marky_2087
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Marky_2087
   00310 Lysine degradation
    Marky_2087
   00360 Phenylalanine metabolism
    Marky_2087
   00380 Tryptophan metabolism
    Marky_2087
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Marky_2087
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Marky_2087
   00281 Geraniol degradation
    Marky_2087
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Marky_2087
   00627 Aminobenzoate degradation
    Marky_2087
   00930 Caprolactam degradation
    Marky_2087
Enzymes [BR:mhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Marky_2087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2101452..2102255
Genome map
AA seq 267 aa AA seqDB search
MDTAKYQALKFQHPAEGVLEIVLEQPERLNAVDQIGHRELAYVWRDVDEDPSVRAVLIRG
SGKGFSAGGDFALIEEMMADYRTLVRVWKEARDLVYNVINCSKPIVSAIHGPAVGAGLAV
ALLADVSIAAKSAKILDGHTRLGVAAGDHAAIVWPLLVGMAKAKYYLLTNEPLNGAEAER
IGLVSLAVEDDALYETALSVAKRLAAGSPTALRWTKYALNNWLRLAGPTFDTSLALEFLG
FLGPDAKEGLAAIKERRRPEFEKDVPL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgcgaagtaccaggccttaaagttccagcaccccgcggagggcgtgctggag
atcgtgctcgagcagccggagcgcctgaacgccgtggatcaaatcgggcaccgcgagctc
gcgtacgtgtggcgcgacgtggacgaggaccccagcgtccgcgcggtcctcatacgcggc
agcggcaaggggttttccgccgggggggatttcgcgcttatcgaggagatgatggcggac
taccggaccctggtgcgggtgtggaaggaggcccgggacctcgtctacaacgtgatcaac
tgctccaagcccatcgtctccgcgattcacgggcccgcggtcggcgcaggactcgcggtc
gcgctgctcgcggacgtctcgatcgcggcgaaaagcgcgaagatcctcgacgggcacacg
cggctcggcgtggccgcgggcgaccacgcggccatcgtctggccgcttttggtcggcatg
gccaaggccaagtactacctcctcacgaacgagccgctgaatggcgcggaggccgaacgg
atcgggctggtctccctcgcggtggaggacgacgcgctttacgagacggccctaagcgtc
gcgaaacgcctcgcggcgggcagccccaccgcgcttcgctggaccaagtacgccctcaac
aactggttgcgcctcgccggccccaccttcgacacctccctcgccctggagttcctgggc
tttttggggccggacgcgaaggaagggctcgccgccatcaaggaacggcgccgcccggag
ttcgagaaggacgtacccctatag

DBGET integrated database retrieval system