KEGG   Mycoplasma haemocanis: MHC_00935Help
Entry
MHC_00935         CDS       T01666                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mhe  Mycoplasma haemocanis
Pathway
mhe00230  Purine metabolism
mhe01100  Metabolic pathways
Module
mhe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mhe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MHC_00935 (gmk)
Enzymes [BR:mhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MHC_00935 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 RsgA_GTPase AAA_16 Rad17 Septin AAA_22 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AEW45053
UniProt: H6N5U3
Position
189668..190294
Genome map
AA seq 208 aa AA seqDB search
MVVGDACNYNFSIQRVGSRKLGKLLIISGPSGVGKGAIIERLLSNKKLNLIFSISHTTRS
RRSNEVDGVNYFFITKEQFRLNIESGKMLEYAQFFDNYYGTSREWVENMLQEGRNVLLEI
ETIGFKQMLEKKIDLVSIFIAPPSMEELEGRLKNRGTESGQDVKIRLEKAASEMADSALF
QHVVVNDVLEDAVREIEGIFLRQILNEN
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
ttggttgtcggtgatgcttgtaattataatttctccattcaaagagtggggtcgcgtaaa
ctaggtaaactacttattatatctggcccttctggagtcggaaaaggagctattattgag
cgactgctgtcaaacaagaaattaaatttaatcttttctatttcccacactactcgaagt
cgtagatctaacgaagtggatggggttaactacttctttataactaaagagcagtttagg
ttgaacatagagtctggcaagatgcttgaatatgctcaattctttgataactattatggt
actagtagagagtgagttgagaatatgcttcaagaggggagaaatgttcttttggagatt
gaaacaataggatttaaacagatgttggagaagaagatcgatttggtatctatatttata
gctcccccctccatggaggagctggaaggtagacttaaaaatagagggacggaatctgga
caggatgtaaagatacgtttagagaaggcggcttctgaaatggcagattcagctctattc
caacatgtggtagttaatgatgttttggaagacgctgttagagagattgaaggaattttt
ctaagacagattttgaatgaaaattaa

DBGET integrated database retrieval system