KEGG   Mycoplasma haemocanis: MHC_05475Help
Entry
MHC_05475         CDS       T01666                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhe  Mycoplasma haemocanis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHC_05475
   01230 Biosynthesis of amino acids
    MHC_05475
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHC_05475
   00030 Pentose phosphate pathway
    MHC_05475
   00051 Fructose and mannose metabolism
    MHC_05475
   00052 Galactose metabolism
    MHC_05475
  Energy metabolism
   00680 Methane metabolism
    MHC_05475
Enzymes [BR:mhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MHC_05475
Protein phosphatases and associated proteins [BR:mhe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MHC_05475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(844949..845947)
Genome map
AA seq 332 aa AA seqDB search
MENKKIAVLTSGGDSPAMNATICSFVASARSCGWDVYGVIDGYKGLIESNFSKLDFRSLR
DKVYCSGTCIGSSRCLEFKNDPTVREKCVENLKRGGFSCLFVIGGDGSYQGANLISKLGF
PVVAAPGTIDNDVSSSNFTIGFFSALEEIFAAVKKIRSTSDSHSQITFLEVMGRDCYDLS
AFAGLASMVDYVITNKNPKSVDEMYEVLESMIRKGSRGIVVLVTERVYGEKFGFGMPSLP
EFCVSLEKRLGRQVRSSVLGYVQRGAIPTSWDLFMSSSFGIKAIECLKAGETGVALGFDG
RNFYSTPLDKAILTPKNSSFKEVEFINSLYKL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaataagaagatagctgtgttgacgtctggaggggattctccagctatgaatgct
actatatgttcttttgtagcgtctgctagaagctgtggttgggatgtttatggagttatt
gatggatataagggtcttatagaatctaatttttctaagttggatttcagatctttgcgg
gataaggtttattgttcggggacttgtattgggtcttctcgttgtcttgaatttaagaat
gatcctactgttagggagaaatgtgttgagaatcttaagagaggtgggttttcttgtctt
tttgttatagggggggacggctcttaccaaggagccaatcttataagtaagttgggtttt
ccggttgtcgctgctccagggactatagataatgatgtttcttcttctaattttacaatc
ggtttcttttccgcgttggaagagatatttgcagctgtaaagaaaattagatccacctca
gactctcattctcaaattactttcttggaggttatgggtagggattgctatgatttatct
gcttttgctggtttggctagcatggtggattatgtcattaccaataaaaatcccaaatct
gtagatgagatgtatgaggttttagagtctatgattcgaaaaggaagtagaggtatagtg
gttttagttacagagagggtttatggtgagaagtttggttttgggatgcctagtcttcct
gaattttgtgtttctttagaaaaaagattggggcgacaggttagatctagcgtcttaggt
tatgttcaaaggggagcgatacctacttcttgagatctttttatgtctagtagttttggt
attaaagctattgagtgcttgaaggccggcgaaactggagttgctttaggttttgatgga
agaaatttctattcaactcctttagataaagccattttaactccaaaaaattcttccttt
aaagaggtagaatttataaattccttgtataagctataa

DBGET integrated database retrieval system