KEGG   Mycoplasma haemocanis: MHC_05725Help
Entry
MHC_05725         CDS       T01666                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhe  Mycoplasma haemocanis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHC_05725
   01230 Biosynthesis of amino acids
    MHC_05725
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHC_05725
   00051 Fructose and mannose metabolism
    MHC_05725
   00562 Inositol phosphate metabolism
    MHC_05725
Enzymes [BR:mhe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MHC_05725
Exosome [BR:mhe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MHC_05725
  Exosomal proteins of bladder cancer cells
   MHC_05725
  Exosomal proteins of melanoma cells
   MHC_05725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(894436..895116)
Genome map
AA seq 226 aa AA seqDB search
MNFLYKDFQDYIENLRMKFLSETPKVHLGLAIPYIYLKNASESIGSKIKVLAQDLHPVDF
GAFTSSVSAAQLASLNVPATLIGHSECRQLSQNSFVISNKVKSALRNGLEIIYCCGEDPE
REISEELFFMNGDEISKVIIAYEPISSIGTGQAMDPNGADSTLLRIRDLISDKYGRKVAD
SMKLLYGGSVNLSNYKGYLEKKNIDGVLVGGASLKVEDLWKMAILE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcctttacaaggattttcaggattatatagagaatctgagaatgaagttcttg
tctgaaactcctaaggttcatttggggttggctattccttacatatacttgaagaatgct
tctgagtctattggatcaaagattaaggtattagctcaagatctgcatcctgtggatttt
ggtgcattcacttcttctgtttccgcagctcaattggcttcgcttaatgttcctgcaaca
ttaattggtcactcggagtgtagacagttgagtcagaattcctttgttatttcgaataag
gtaaagtctgctctaagaaatggattggaaattatctattgttgtggagaagatcctgag
agggagatatctgaagagttgtttttcatgaatggagatgagataagtaaggtgataata
gcttacgaacctatttcttctataggaactggtcaagctatggatcctaatggagctgat
tctacccttcttagaataagggatctaatatctgataagtatggaagaaaggtagctgat
tcaatgaagttattgtacggtggttctgttaatttatccaactataagggctatttggaa
aagaaaaatatagacggagttttagttggtggggcttccttgaaggttgaggatctttga
aagatggcaatcttagagtaa

DBGET integrated database retrieval system