KEGG   Megamonas hypermegale: MHY_02300Help
Entry
MHY_02300         CDS       T02593                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mhg  Megamonas hypermegale
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MHY_02300
Enzymes [BR:mhg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MHY_02300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(158912..160360)
Genome map
AA seq 482 aa AA seqDB search
MHPTSLPSDYGIGDLGKEAYNFVDWLVKAKQKIWQVLPLNPVGYGASPYQSPSAFAGNTM
LISPEKLVEINLLEAKDIVLDYKADADKVDFVKVEAYKEKILTKAFVNFVTDADYTAFCQ
QQSYWLEDYALFMALKKYYKNLPWYEWNLDIKLRKPQALESCRISLAQDIAYAKFKQYIF
FKQWQDLHAYANEKGIQIVGDVPIFPSHDSADVWVHQDLFNLNADGTLKTAAGVPPDYFS
EDGQLWGNPHYLWKVMQRDDYSWWRKRIATLLNLVDIIRIDHFRGFEAYWEVSGMATNAR
VGKWVKGPGKDLFDKIKEYLGDVPIIAEDLGVITPEVEALKNSCNFPGMKVLQFELYANK
YHKLNFISPKNSIVYTGTHDNNTTLGWLKEDISPQDKAVLADLLEVKVDDNEALLEELVK
LAYASASKMAILPMQDVLKLDSNARMNLPGTVGTNWGWRMQKDTLTDEKAMYLCSLVEKY
NR
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcatccaacatcacttccatctgattatggtattggtgatttaggaaaagaagcttat
aattttgtggattggttagtaaaagctaaacaaaagatttggcaagttctgccattaaat
ccagtgggatatggagcatctccatatcaatctccatctgcttttgctggcaatactatg
cttatttcacctgaaaaattagtggaaatcaatttattggaagctaaagatattgtttta
gattataaagctgatgctgataaagtagattttgtaaaagtagaagcttataaagagaaa
atcttaacgaaagcttttgttaattttgtaacagatgcagattatactgctttttgtcaa
cagcaaagttattggcttgaagattatgcactattcatggcattaaagaaatattataaa
aacttaccatggtatgaatggaatttagacataaaattgcgtaaacctcaagctttagag
tcttgtagaatttctttggcacaagatattgcttatgctaagtttaaacaatatattttc
tttaaacagtggcaggatttacatgcttatgcaaacgaaaaaggcatacaaatagtaggt
gatgttcctatcttcccatcgcatgatagtgctgatgtatgggtacatcaagatttattt
aatttgaatgctgatggcaccttaaagacagcagcaggagtgccaccagattatttcagt
gaagatggtcaactttggggcaatccacattatctctggaaggtaatgcaaagagatgac
tatagttggtggcgtaaacgtatagctacattgttgaatttagtagatataattcgcatt
gaccatttccgtggttttgaagcttattgggaagtatctggtatggccacaaatgctcgt
gttggtaaatgggttaaaggtccaggcaaagatttatttgataaaatcaaagaatattta
ggtgatgtgccaatcattgctgaagacttaggtgtaatcactccagaagtcgaagctttg
aaaaatagttgtaatttcccaggcatgaaagttttgcaatttgaattatatgcaaataaa
tatcataaattaaattttatcagtccgaaaaatagtattgtctatacaggcactcatgac
aataatacaactttaggctggcttaaagaggatatatctccgcaggataaagcagtttta
gcagatttattagaagttaaagttgatgataatgaggctttattagaggaattggtaaaa
ttagcatatgctagtgcctctaagatggcgatattgccaatgcaagatgttttgaagttg
gatagtaatgctagaatgaatttacctggtacagtaggcactaattggggctggcgcatg
caaaaagatacattgacagacgaaaaagcaatgtatttgtgttccttagtagaaaaatat
aatagataa

DBGET integrated database retrieval system