KEGG   Megamonas hypermegale: MHY_04720Help
Entry
MHY_04720         CDS       T02593                                 

Definition
Hexokinase (EC:2.7.1.1)
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
mhg  Megamonas hypermegale
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MHY_04720
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MHY_04720
   00051 Fructose and mannose metabolism
    MHY_04720
   00052 Galactose metabolism
    MHY_04720
   00500 Starch and sucrose metabolism
    MHY_04720
   00520 Amino sugar and nucleotide sugar metabolism
    MHY_04720
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MHY_04720
   00524 Butirosin and neomycin biosynthesis
    MHY_04720
Enzymes [BR:mhg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     MHY_04720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(363913..365196)
Genome map
AA seq 427 aa AA seqDB search
MDNKKFQEMIDEFTLDSDAIKDVAASFRYDIEHGVKETGESSLRMLPSYIGLPTGKETGE
YLALDFGGTNLRVVLIRLDGEGKFEVIKKVAKPLVVPGEYDFICADANADELFDFIADMV
EEAVDGNRDKKYLLGHTFSFPSSQTNIYNARLIIWTKEFATKGVEGEVVNDLLKAALARK
NLTNVEPTAVINDTVAVLLAAAYKLGNVNIGSIYATGHNTCYYETFTGMDKPAMVINMES
GGFNKLAINKYDYKLDMESEKPYEQRLEKMVSGRYMGELLSYCLDDAWNIGKVEFTSIDI
STILADNSDSLDGVCDLLKAKINADITTDDAIWVKALAETIASRSARLVVATYCGIMWHL
YPNGGIPKQFVAVDGSVYEKMPTIKDNMQKAIYEILGEEADKLELVLENGGSALGAALAA
AMEPVEC
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggataacaaaaaatttcaagaaatgattgatgaatttacacttgatagcgatgccata
aaagatgtagcagcatcttttcgctatgatatagaacatggcgtaaaagaaacaggagaa
tcttctttacgtatgttaccatcttatatcggtttacctactggtaaagaaacaggagaa
tacttagcacttgattttggtggcacaaatcttcgtgtagttttaattcgtttagatggt
gaaggcaaattcgaagttattaaaaaagttgctaaaccattagtagtgccaggcgaatat
gattttatttgcgctgatgcaaatgctgatgaattatttgattttatcgctgatatggta
gaagaagctgttgatggcaatcgcgataaaaaatacttattaggacatactttctctttc
ccatcttctcagacaaatatttataatgcacgtcttatcatttggactaaagaatttgca
acaaaaggtgttgaaggtgaagttgtaaatgatttattaaaagcagctttagctcgtaaa
aatcttacaaatgttgaaccaacagcagttatcaatgatacagtagcagttttattagca
gctgcatacaaattaggtaatgtaaatattggttctatctatgctacaggtcataataca
tgctattatgaaacattcactggtatggataaacctgcaatggttataaatatggaatct
ggcggatttaataaactcgctatcaataaatatgattacaaattagatatggaatctgaa
aaaccatatgaacaacgtttagaaaaaatggtttctggtcgttatatgggtgaattatta
tcttattgcttagatgatgcttggaatattggcaaagtagaattcacaagtattgatata
tccactattttagctgataacagcgatagtttagatggagtatgtgatttattaaaagca
aaaatcaatgcagatataactacagatgatgctatttgggtaaaagctttagctgaaaca
atcgctagccgttctgcaagattagtagttgctacttattgcggtattatgtggcattta
tatccaaatggtggtattccaaaacaatttgtagctgtagatggttctgtatatgaaaaa
atgcctacaataaaagacaatatgcaaaaagctatttatgaaattttaggcgaagaagct
gacaaattagaacttgtattagaaaatggtggttctgcacttggtgcagcactcgctgca
gctatggaacctgttgaatgctaa

DBGET integrated database retrieval system