KEGG   Megamonas hypermegale: MHY_05700Help
Entry
MHY_05700         CDS       T02593                                 

Definition
Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mhg  Megamonas hypermegale
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MHY_05700
Enzymes [BR:mhg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MHY_05700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
444665..445219
Genome map
AA seq 184 aa AA seqDB search
MDRKEMTYHDVVVIDLDANVIEAETAQRRPTSESLMHLEVYKQHPDINAVAHTHSKYATA
FAVLKKPLPAVVYEILGLGCKEGIVPVADFGRPGTPELAINTVKALEKSDVALMQAHGVI
AIDKDLKEALLKASYVEELAEIYYHTLVINNGNEPPYVSDSELQKWEYPKEIKLLDSLTR
TSSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatagaaaagaaatgacctatcatgatgttgttgttatagatctagatgctaatgtt
attgaagcagaaactgctcaacgtagaccgactagtgaaagtttaatgcatttggaagta
tataaacaacatcctgatatcaatgccgtagctcatactcattcaaaatatgctactgct
tttgctgttctaaaaaaacctttacctgccgttgtttatgaaatcttaggtcttggttgt
aaagaaggaattgttcctgttgctgattttggtagaccaggaacaccagaactagctatt
aacactgtaaaagctttagaaaaatcagatgttgctttaatgcaagcacatggtgtaatc
gctattgataaagatttaaaagaagctctcttaaaagctagttatgtagaagaattagct
gaaatttattatcatactcttgttattaacaatggtaatgaacctccttatgtatcagat
agtgaacttcaaaaatgggaatatcctaaagaaattaaactattggattcattaactaga
acatcttcaaaataa

DBGET integrated database retrieval system