KEGG   Megamonas hypermegale: MHY_17160Help
Entry
MHY_17160         CDS       T02593                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mhg  Megamonas hypermegale
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mhg00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mhg00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mhg00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1269970..1272201
Genome map
AA seq 743 aa AA seqDB search
MQILFNEQSRTFHLTNDKISYIMTVLPNGHLSQVYFGKKVHDKADFSYLIQSCARPTTSY
ISEEFHNIISLSHIRQEYPVYGTSDYRQPAIEICQTNGSKISDFHYQSHSISKGKPKLEN
LPATYTENDDEALTLTIHLQDPVTLVEIDLLYTIFAQNGIIARSAKIYNQGKDDVHLTTA
MSLCLDLPDCDYEWLQFSGTWSRERHLKVRKLEQGITAINSTRGHSSHEHNPFIILKRPT
TDENKGEAIGFSLIYSGNFLAQAEVDTHDVTRVLMGINPTTFDWKLEPNTSFQTPEAVMI
YTDDGLNNLSQSFHKLFQKRLARGYWRDKARPILINNWEATYFDFNEDKLVTIASKAKEC
GVELFVLDDGWFGKRTSDYAGLGDWYPNTDRLPNGIKGLAERIENLGMKFGLWIEPEMTN
MDSDLYRNHPDWILHVPGRHSSECRHQYVLDYSRKEVVDYIYNLLAKILREAKISYIKWD
MNRSITECYSVAYPADRQGEIFHRHILGVYDLYERLTSEFPHILFESCASGGARFDPGLL
YYAPQGWASDDSDAIERLKIQYGTSFAYPISSIGSHVSVTPNHQVYRLTPLHTRANVAYF
GTFGYELDLNKLTPAEQEEVKEQIKFMKEYREVFQFGTFYRLSSPFENNVTAWMVVSEDK
ETAIVGWYRVLNGINLPYSRIYLQGLNPDFCYQQSIDGKSYFGDELMNIGLVIDDPSAGQ
PYGDMATSCDFDSKVYVLKAINK
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattttatttaatgaacaaagccgtacttttcatttaactaatgataaaattagt
tacattatgactgtacttcctaatggtcatctaagccaagtatattttggtaaaaaagta
catgacaaagcagatttttcctatttaattcaatcttgtgctcgtccaacaacttcttat
atttctgaagaattccataatattatatctttgagccatattcgtcaagaatatcctgtt
tatggtacttctgattatcgtcagcctgctattgaaatttgccagacaaacggcagtaaa
atttctgacttccattatcaaagtcattctatcagcaaaggcaaaccaaaacttgaaaat
ttacctgctacttacacagaaaatgatgatgaagctctcactttaactattcatttacaa
gaccctgtaactttagttgaaatagatttactctacactatttttgctcaaaatggcatt
atcgctcgcagtgctaaaatctacaatcagggtaaagatgatgttcatttaacaacagcc
atgagcctttgccttgatttacctgattgcgattatgaatggcttcaattctctggtaca
tggtctagagaacgtcatttaaaagtgcgtaaattagaacagggtatcactgctattaat
tccactcgtggtcattcttcccatgaacataatccatttattattttaaaacgacctact
acagatgagaataaaggggaagctattggctttagcttaatctatagcggtaacttctta
gctcaagcagaagttgatactcatgatgttacacgcgttttaatgggtattaatccaact
acatttgattggaaattagaaccaaatacatctttccaaactccagaagctgtaatgatt
tatactgatgatggcttaaataatttaagtcaatctttccataaattattccaaaaacgc
cttgctcgtggctattggagagataaagctagacctattttaatcaataactgggaagct
acttatttcgatttcaatgaagataaactcgtaactatcgctagcaaagctaaagaatgt
ggcgtagaattattcgtattagatgatggctggttcggcaaacgcacttccgattatgca
ggtcttggcgattggtatccaaatactgaccgcttaccaaatggcatcaaaggtcttgca
gaaagaattgaaaatctcggcatgaaattcggtctttggattgaaccagaaatgactaat
atggactctgacctctatcgcaatcatccagattggattttacatgtacctggcagacac
tcttctgaatgtcgtcatcaatatgttctcgattattctcgtaaagaagtagtagattat
atttataatttactcgctaaaatcttacgtgaagctaaaatttcctatattaaatgggat
atgaaccgcagtattacagaatgttattccgtagcttatcctgctgatagacaaggagaa
atcttccatcgtcatatcttaggtgtttacgatttatatgaacgcttaacttctgaattt
cctcatattctctttgaatcttgtgctagtggtggtgctagatttgatccaggtctttta
tattatgctccacaaggctgggcaagtgatgactccgatgctatagaacgcttaaaaatc
caatatggtacatcttttgcttaccctattagctctatcggcagtcatgtttctgttact
cctaaccatcaagtatatcgcttaacacctcttcatactagagcaaatgttgcttacttt
ggtacttttggctatgagcttgatttaaataaattaactccagctgaacaagaagaagta
aaagaacaaattaaattcatgaaagaatatcgtgaagttttccaatttggcacattctat
cgtttgagcagtccttttgaaaataatgtaactgcttggatggtagtaagcgaagataaa
gaaactgctattgttggttggtatcgtgtattaaacggtataaatttaccatatagcaga
atttatctccaaggtttaaatccagatttctgctatcagcaaagtattgatggtaaatct
tatttcggtgatgaactcatgaatatcggtcttgtaattgatgatccaagtgcaggtcaa
ccatatggtgatatggctacaagctgtgatttcgattctaaagtttatgtattaaaagca
ataaataaataa

DBGET integrated database retrieval system