KEGG   Megamonas hypermegale: MHY_19910Help
Entry
MHY_19910         CDS       T02593                                 

Definition
Glycosyl hydrolase family 9./N-terminal ig-like domain of cellulase. (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mhg  Megamonas hypermegale
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MHY_19910
Enzymes [BR:mhg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MHY_19910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1496694..1498460)
Genome map
AA seq 588 aa AA seqDB search
MYNKKKLSQIILSGLMAVSFSSISLPIEAADMGLHVDQVGYLPNYSKVAMVTDSNDTTFE
IIDTKDNKVVFKGNLSEPKYDKISEETLRKADFSSLNVPGTYILKVGNRESYDFVIGDDV
YDVPMVQSWRSYTLSRTNTAINDDKVSGLKLEGGHKQDKEARVYFSDKLNNKGDKIDVSG
GWYDAGDYGKYITTGALSSAELLLAYEANPDHFTKGQLLFPKGIENNTNMPDVLSEVKFE
LDWMEKMQREDGSTFHKVSGLTWPGLDISPDTDKQDRYIFSTATSSTAMYGASLAIASRV
YEQYDKDYAKNLKQNAEAVWQYLEKNPKPIYRVDEGQENGSGPYNKNTDLEERLWLAAEM
FRTTGDAKYESYLKKESKRLTDKPSFFTWDDTLALAQFAYAKSNNADKQLQNKVINALSS
YADDICTSIKTDSFNCSLKENEYTWASTKNALTKGDILLMAYQIKPKQEYLEGALAQIHY
LFGRNSLDKSFMTGVGDNPPLHPHNRIHESTGAYVSGLVVGGPNHVIGGDPDQTEYLNSG
NIPIAKSYLDVVGSWSTNEYAIDYISSAVYALSWFAEPDSVKVEDFKI
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtataataagaaaaaactcagtcaaattattttatctggattaatggcggtaagtttt
tcatcgatatcactacctatagaagcagctgatatggggctacatgttgaccaagtagga
tatctgccaaattattcaaaagtagcaatggtaactgactctaatgatactacttttgaa
ataattgatacaaaagataataaagttgtatttaaaggaaatttatctgaacctaaatat
gataaaatttctgaagaaactttacgtaaagccgatttttcttctttgaatgtaccagga
acatatattttaaaagtaggtaatcgtgaatcatatgattttgtaattggtgatgatgtc
tatgatgtacctatggtacaaagttggcgttcatatactttatcaagaactaatactgct
ataaatgatgataaagtttctggactaaaattagaaggtggacacaagcaagataaagaa
gctcgtgtttatttctctgataaattaaataataaaggtgataaaatagatgttagtggt
ggatggtatgatgcaggagattatggtaaatatataacaacaggagcattaagtagtgct
gaattattgttagcatatgaagcaaatcccgatcatttcactaaaggtcaattgttattt
ccaaaaggcatagaaaataatacaaatatgccagatgttttatcagaggtaaaatttgaa
cttgactggatggaaaaaatgcaacgtgaagatggcagtacattccataaagtatcaggt
ttgacttggccaggattggatatttctccagatacagataagcaagatagatatattttt
agtacagctacttctagtacagctatgtatggtgcaagtttagcaatagcttcacgtgta
tatgaacaatatgataaagattatgctaaaaatttaaaacaaaatgctgaagctgtttgg
caatatttagaaaaaaatcctaaaccaatttatcgtgttgatgaaggacaagaaaatggt
tcaggcccatataataaaaatacagatcttgaagaacgtttatggttagctgcagaaatg
tttagaacaacaggtgatgctaagtatgaatcttatttgaagaaagagtctaaacgttta
actgataaaccaagcttttttacatgggatgatactttagctttagcacaatttgcatat
gctaaatctaataatgcagataagcaacttcaaaataaagttattaatgctttaagtagt
tatgcagacgatatttgtacaagtataaaaacagatagttttaattgttctttaaaagaa
aatgaatatacatgggcttcaactaaaaatgctttgactaaaggtgatattttattaatg
gcatatcaaattaagccaaaacaagaatatttagaaggagcactagcacaaattcattat
ctttttggaagaaattcacttgataagagttttatgactggtgtaggagataatccacca
ttacatccacataatcgtatccatgaaagcacaggagcttatgtttcaggtcttgttgtc
ggtggaccaaatcatgttataggtggagatccagaccaaacagaatacttgaatagtgga
aatattcctatagcaaaatcttatcttgacgtggtaggttcttggtctacaaatgaatat
gctatagattatatttcatctgctgtttatgctttatcttggtttgcagaaccagactca
gttaaagttgaagattttaaaatataa

DBGET integrated database retrieval system