KEGG   Megamonas hypermegale: MHY_26700Help
Entry
MHY_26700         CDS       T02593                                 

Definition
Sugar kinases, ribokinase family (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mhg  Megamonas hypermegale
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mhg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MHY_26700
Enzymes [BR:mhg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MHY_26700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1999642..2000514
Genome map
AA seq 290 aa AA seqDB search
MKILNFGSLNIDKVYAVEKIVKGGETIDSVSFSESVGGKGLNQSIAVAKAGGNIMHAGCV
GKDGEILLQALKDNNVDTSLIKTVETASGQAIIQVDKHGQNCIILFHGANYEVDKAYIDE
VMQDFAQGDILILQNEISNIDYIIEVAKAKQMKIYLNPSPINENLNKYNMQAIDGIFVNE
HEGAYLAGKEKVEDILDSLASKYPELEIILTFGDKGAYYRHKDINIFQPAYKVDAVDTTA
AGDTFTGYFIALRQQGKSIEESLQKASKASSITVSRKGASISIPKIAEVD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttaaatttcggttcgttaaatattgataaggtttatgctgttgaaaaaatt
gtaaaaggcggagaaactatcgactccgtaagttttagtgaaagtgtaggcggtaaaggt
ttaaatcagtcaattgccgtagctaaagctggcggaaatatcatgcatgctggttgtgtt
ggtaaagatggagagattttattacaagctttaaaagataataatgtagatacatctttg
attaaaacagtagagacagcaagcggacaggctattattcaagttgataaacatggacag
aattgcattattttattccatggagctaattatgaagtggacaaagcttatattgatgaa
gtgatgcaagattttgcacaaggtgatattttaattttacaaaatgaaatttccaatatt
gattatattattgaagtagcaaaagctaaacaaatgaaaatttatctaaatccttcacca
atcaatgaaaaccttaataaatataatatgcaggcaatagatggaatttttgtcaatgaa
catgaaggggcatatttagctggtaaagaaaaagttgaagatatattagatagtttagct
agcaaatatcctgaattagaaatcattttaacttttggtgataaaggtgcatattatcgt
cataaagatataaatattttccaacctgcatataaagttgatgctgtagatacaacagct
gctggagatacttttacaggctatttcattgctttaagacaacaaggtaaatccattgaa
gaaagtttacaaaaagcaagtaaagcatcttcaattacagtatcaagaaaaggagcaagc
atttctattcctaaaattgcagaagtggattga

DBGET integrated database retrieval system