KEGG   Megamonas hypermegale: MHY_27740Help
Entry
MHY_27740         CDS       T02593                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
mhg  Megamonas hypermegale
Brite
Enzymes [BR:mhg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     MHY_27740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2083213..2083542
Genome map
AA seq 109 aa AA seqDB search
MITSGAEPFLLPGGSKGVLLIHGFTGSPSEMILLGNYLYRQGYTVLGVRLAGHGTTVEEM
ANTNWHEWYHSACDGYHLLRGICSEISVIGLSMGGLLAMRIGRDFPVKK
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgattactagtggtgcagagccatttttgttacctggaggttcaaagggtgtattattg
atacatggatttacaggctcgccttctgaaatgatattattaggaaattatttatataga
caaggctatactgtattaggtgtgcgtttagctggtcatggtacgactgtagaagaaatg
gctaatactaattggcatgaatggtatcatagtgcatgtgatggatatcatttattgcgt
ggcatttgcagtgaaatatctgtaattggtctatctatgggcggtttattggctatgcga
attggcagggatttccctgtgaaaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system