KEGG   Megamonas hypermegale: MHY_27750Help
Entry
MHY_27750         CDS       T02593                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
mhg  Megamonas hypermegale
Brite
Enzymes [BR:mhg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     MHY_27750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2083548..2083946
Genome map
AA seq 132 aa AA seqDB search
MSAPVYIANERNLRFLPPLEKSVGRYQRKNRRELPELAKRYNVSYNKMPLVCVHQLLEII
AKTKEILPEISKPILIVQSKNDHTVKEESGQYIYDHIGSKDKQLFKLIFSGHLVTLDIEH
DKLFNKIENFLK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcctgtatatatagctaatgaacgcaatttaagatttttaccaccacttgaa
aaatcagtgggacgatatcagcgtaaaaatagacgagaattacctgaactagctaaaaga
tacaatgtatcttataataaaatgccacttgtctgtgtgcatcaattgttggagataata
gccaaaacaaaagaaattctaccagaaatttcaaaaccaattttgattgttcaaagtaaa
aatgaccatacagtaaaagaagaaagtggtcaatatatttatgaccatattggtagcaag
gataaacaattatttaaattaattttttcaggtcatttagttactttagatattgaacat
gataaattatttaataaaatagagaattttttgaaataa

DBGET integrated database retrieval system