KEGG   Mycoplasma hyorhinis GDL-1: MYM_0063Help
Entry
MYM_0063          CDS       T01730                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mhh  Mycoplasma hyorhinis GDL-1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mhh00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mhh00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
79485..79988
Genome map
AA seq 167 aa AA seqDB search
MIISILAMGKNNLIGKGDDLPWYVKEDFDFYREQTKHHDILVGKNTFFTLPKSLQKWSKI
YIVSDDKNFNYENENVKTINNFSNLIKEYQNHPSKHLFVSGGYTLYKSIINKCDQLIISF
IKGEHSGDIFLNELKWEKFEEISSKDKGKFIVKNIKRQSNLIKFFLV
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgataatttcaattttagccatgggcaaaaataatttaataggaaaaggcgatgattta
ccttggtatgtaaaagaagactttgatttttatagagaacaaacaaaacatcatgatatt
ttagtaggaaaaaatactttctttactttaccaaaatcacttcaaaaatgaagcaaaatt
tatattgttagtgatgataaaaattttaattacgaaaatgaaaatgtgaaaacaataaat
aatttttctaatctaattaaagaatatcaaaatcatcctagtaaacatttgtttgtttca
ggaggatatactttgtacaaaagcattataaataagtgtgatcaattaataatttccttt
atcaagggagaacactctggtgatatttttttaaatgaactaaaatgagaaaaatttgaa
gaaatttcttcaaaagataaaggaaaatttatagtaaaaaatataaaaagacaaagtaat
ttgataaaattttttttggtttaa

DBGET integrated database retrieval system