KEGG   Mycoplasma hyorhinis GDL-1: MYM_0166Help
Entry
MYM_0166          CDS       T01730                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhh  Mycoplasma hyorhinis GDL-1
Pathway
mhh00010  Glycolysis / Gluconeogenesis
mhh00051  Fructose and mannose metabolism
mhh01100  Metabolic pathways
mhh01110  Biosynthesis of secondary metabolites
mhh01120  Microbial metabolism in diverse environments
mhh01130  Biosynthesis of antibiotics
mhh01200  Carbon metabolism
mhh01230  Biosynthesis of amino acids
Module
mhh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mhh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mhh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYM_0166 (tpiA)
   00051 Fructose and mannose metabolism
    MYM_0166 (tpiA)
   00562 Inositol phosphate metabolism
    MYM_0166 (tpiA)
Enzymes [BR:mhh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MYM_0166 (tpiA)
Exosome [BR:mhh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MYM_0166 (tpiA)
  Exosomal proteins of bladder cancer cells
   MYM_0166 (tpiA)
  Exosomal proteins of melanoma cells
   MYM_0166 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM AlphaC_C DUF1647 FtsZ_C tify
Motif
Other DBs
NCBI-ProteinID: AEX13962
Position
211482..212213
Genome map
AA seq 243 aa AA seqDB search
MSKTIIIGNWKMNKTFTQTKEFFSAFNQLYIENKNKINQNLDFAVALPAINVAAFSKNTT
KLELAVQNMSQFEKGAYTGEISAQMLLDLNVKYAIIGHSERRQYFKETDLDVNAKTQQAI
KNNIIPVVCVGETLEEYEAQKTSQVIEYQLKNSLKDVDLSKVIVAYEPIWAIGTGKTATP
EQAQQVCKFIRKQTNKNLTILYGGSVSQENIEQLLNQADINGALVGGASLKVDSFIKLLT
LNK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaactattattattggtaattgaaaaatgaataaaacttttacacaaacaaaa
gaatttttttctgcttttaatcaactatacatagaaaataaaaacaaaattaatcaaaat
ttggattttgcagttgcacttcctgcaataaatgtagctgcatttagtaaaaatacaaca
aaattagaattagcagttcaaaatatgtcacaatttgaaaaaggagcttatactggcgaa
atttctgcgcaaatgttattggatttaaatgtcaaatatgctattattggtcattcagaa
agaaggcaatattttaaagaaactgatttagatgtaaatgcaaaaacacaacaagcaatt
aaaaataatattattccagttgtttgtgtgggggaaacattagaagaatatgaagcacaa
aaaacaagtcaagtaattgaatatcaactaaaaaattcattaaaagatgtagatttaagc
aaagttatagtggcttacgaaccaatttgagcaattggtacaggaaaaactgctacacca
gagcaagcacaacaagtttgcaaatttattagaaaacaaacaaataaaaatttaactatc
ttatatggtggctcagtttctcaagaaaatatagagcaattattaaatcaagcagatatt
aacggagcgctagttggaggagcatctttaaaagtagattcatttataaaattattaact
ttaaacaaataa

DBGET integrated database retrieval system