KEGG   Mycoplasma hyorhinis GDL-1: MYM_0585Help
Entry
MYM_0585          CDS       T01730                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhh  Mycoplasma hyorhinis GDL-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYM_0585 (pfkA)
   01230 Biosynthesis of amino acids
    MYM_0585 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYM_0585 (pfkA)
   00030 Pentose phosphate pathway
    MYM_0585 (pfkA)
   00051 Fructose and mannose metabolism
    MYM_0585 (pfkA)
   00052 Galactose metabolism
    MYM_0585 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MYM_0585 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MYM_0585 (pfkA)
Enzymes [BR:mhh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MYM_0585 (pfkA)
Protein phosphatases and associated proteins [BR:mhh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MYM_0585 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(665705..666676)
Genome map
AA seq 323 aa AA seqDB search
MIKKIGILTSGGDAPGMNNAVRAVAKKALLHNIEPLLIKEGYKGILTKQIVPAKNFDLDK
ASSEGGTIIFSSRFPEFQNNLVRQEAKAILDEFGIQALVAIGGDGTYKGAYELHKLGVKV
IGLPGTIDNDIQETDFTIGFDTALNSIVESVDRLRDTSRSHKRCFIVEVMGRDCQDLALY
GGIATGAEIIITNTHILTEEQIVNLVDQQMNQQGKTSTIVLTSEHIYKDLKAIAKFVENK
TGIATRAMSLEHTQRGGRPTAFERILATQMGHKAVELLLENKSGLAISHKNGKIEAVDIT
KVFVTKQPQDDKLVLEYNKLNQI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaataggtatcttaacatctggaggtgatgctccaggaatgaataatgct
gttagagcagttgctaaaaaagctttattacacaatatagaacctttattaattaaagaa
ggttataaaggaattttaaccaagcaaattgttccagcaaaaaattttgatttggataaa
gcttcttcagaaggaggaacaataattttttcttcaagattcccagagtttcaaaataat
ttggttagacaagaagcaaaagcaatattagatgaattcggaatccaagcactagtagca
attggtggtgatggaacatacaaaggagcctatgaacttcataaattaggagttaaagtt
attggtcttccaggaacaatcgacaatgatattcaagaaacagattttacaattggtttt
gatactgctttaaattctattgttgaatcagttgatagattaagagatacaagtagatca
cacaagagatgttttattgttgaagtaatgggaagagattgtcaagacttggcgctttat
ggtggaattgcaactggagctgaaattattattacaaatactcacattttaactgaagaa
caaatcgttaatttagttgatcaacaaatgaatcagcaaggaaaaacaagcacaattgtt
ttaacttctgaacacatttataaagacttaaaagcaattgctaagtttgttgaaaataaa
acaggtatagcaactagagcgatgtcactggaacatacacaaagaggaggaagaccaact
gcatttgaaagaattttagccactcaaatggggcacaaagcagttgaactacttttagaa
aataaatcaggcttagcaatcagccataaaaatggtaaaattgaggctgtagacattacc
aaagtgtttgttactaaacaaccccaagacgataaactagtattagaatacaacaaatta
aatcaaatttaa

DBGET integrated database retrieval system