KEGG   Mycoplasma hyorhinis GDL-1: MYM_0585Help
Entry
MYM_0585          CDS       T01730                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mhh  Mycoplasma hyorhinis GDL-1
Pathway
mhh00010  Glycolysis / Gluconeogenesis
mhh00030  Pentose phosphate pathway
mhh00051  Fructose and mannose metabolism
mhh00052  Galactose metabolism
mhh00680  Methane metabolism
mhh01100  Metabolic pathways
mhh01110  Biosynthesis of secondary metabolites
mhh01120  Microbial metabolism in diverse environments
mhh01130  Biosynthesis of antibiotics
mhh01200  Carbon metabolism
mhh01230  Biosynthesis of amino acids
mhh03018  RNA degradation
Module
mhh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYM_0585 (pfkA)
   00030 Pentose phosphate pathway
    MYM_0585 (pfkA)
   00051 Fructose and mannose metabolism
    MYM_0585 (pfkA)
   00052 Galactose metabolism
    MYM_0585 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MYM_0585 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MYM_0585 (pfkA)
Enzymes [BR:mhh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MYM_0585 (pfkA)
Protein phosphatases and associated proteins [BR:mhh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MYM_0585 (pfkA)
Messenger RNA biogenesis [BR:mhh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MYM_0585 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEX14326
Position
complement(665705..666676)
Genome map
AA seq 323 aa AA seqDB search
MIKKIGILTSGGDAPGMNNAVRAVAKKALLHNIEPLLIKEGYKGILTKQIVPAKNFDLDK
ASSEGGTIIFSSRFPEFQNNLVRQEAKAILDEFGIQALVAIGGDGTYKGAYELHKLGVKV
IGLPGTIDNDIQETDFTIGFDTALNSIVESVDRLRDTSRSHKRCFIVEVMGRDCQDLALY
GGIATGAEIIITNTHILTEEQIVNLVDQQMNQQGKTSTIVLTSEHIYKDLKAIAKFVENK
TGIATRAMSLEHTQRGGRPTAFERILATQMGHKAVELLLENKSGLAISHKNGKIEAVDIT
KVFVTKQPQDDKLVLEYNKLNQI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaataggtatcttaacatctggaggtgatgctccaggaatgaataatgct
gttagagcagttgctaaaaaagctttattacacaatatagaacctttattaattaaagaa
ggttataaaggaattttaaccaagcaaattgttccagcaaaaaattttgatttggataaa
gcttcttcagaaggaggaacaataattttttcttcaagattcccagagtttcaaaataat
ttggttagacaagaagcaaaagcaatattagatgaattcggaatccaagcactagtagca
attggtggtgatggaacatacaaaggagcctatgaacttcataaattaggagttaaagtt
attggtcttccaggaacaatcgacaatgatattcaagaaacagattttacaattggtttt
gatactgctttaaattctattgttgaatcagttgatagattaagagatacaagtagatca
cacaagagatgttttattgttgaagtaatgggaagagattgtcaagacttggcgctttat
ggtggaattgcaactggagctgaaattattattacaaatactcacattttaactgaagaa
caaatcgttaatttagttgatcaacaaatgaatcagcaaggaaaaacaagcacaattgtt
ttaacttctgaacacatttataaagacttaaaagcaattgctaagtttgttgaaaataaa
acaggtatagcaactagagcgatgtcactggaacatacacaaagaggaggaagaccaact
gcatttgaaagaattttagccactcaaatggggcacaaagcagttgaactacttttagaa
aataaatcaggcttagcaatcagccataaaaatggtaaaattgaggctgtagacattacc
aaagtgtttgttactaaacaaccccaagacgataaactagtattagaatacaacaaatta
aatcaaatttaa

DBGET integrated database retrieval system