KEGG   Mycoplasma hyorhinis GDL-1: MYM_0695Help
Entry
MYM_0695          CDS       T01730                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mhh  Mycoplasma hyorhinis GDL-1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mhh03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(784925..785761)
Genome map
AA seq 278 aa AA seqDB search
MPELPEVVTVVNQLNEKIINKKVVSVKLYKEKLLKNSTVEQLENWFVNEKILSVKNKGKF
IVFYFSNDKILISHLRMNGKYFFNNSSKKEPHNHLMIQFDDNTFLHYNDTRMFGTFHIKT
TKDYLNTTPLSNVGPTPMEISEEELFNKLQKSKRSIKPTLLDQQIVSGLGNIYVDEVLFA
CSIHPLTKAFLINKNELKLIKKFATSILLKSIELGGSTINSYSSLNMQEGNFQNFLQVHT
KKGFACSRCNNIIEKITVGGRGTYICSNCQNEKKQSKL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagttgttacagttgttaatcaactaaatgaaaaaattatcaat
aaaaaagtagtttctgtcaaactttataaagaaaaattactaaaaaattccacagttgag
caattagaaaactgatttgtaaatgagaaaattttaagtgtaaaaaacaaaggaaaattc
attgttttttattttagtaatgacaaaattctaatttctcatttaaggatgaatgggaaa
tatttttttaataactcatctaaaaaagaaccacacaatcatttgatgattcaatttgat
gataatacttttttacattacaatgacacaaggatgtttggtacttttcatattaaaaca
acaaaagattatttaaacacaactcctttatctaatgttggaccaactccaatggaaatt
agtgaagaagaattatttaataaattacaaaaaagtaaaagatctattaaaccaacttta
ctagatcaacaaattgtttctggtttgggaaatatttatgttgatgaagttctttttgct
tgttcaattcatcccttaactaaagcgtttttgataaacaaaaatgaattaaaattaatt
aaaaaattcgccacttcaatattattaaaatcaatagaactaggtggttcgacaattaat
tcatattcctccttaaatatgcaagagggtaattttcaaaattttttacaagttcatact
aaaaaaggttttgcttgttcaagatgtaataatataatagagaaaattacagtaggagga
agaggaacatatatttgttccaattgtcaaaatgaaaaaaaacaaagtaaactataa

DBGET integrated database retrieval system