KEGG   Methanosaeta harundinacea: Mhar_0025Help
Entry
Mhar_0025         CDS       T01990                                 

Definition
Class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mhi  Methanosaeta harundinacea
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mhi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29594..30142
Genome map
AA seq 182 aa AA seqDB search
MDPRKEISKFGSKIVSSGLTYAHFGNISLLSEGMILITSTGSILDELTEDEVIAVTPEAP
CPEDALASCETVVHRAIYEKTTARAVIHTHSPYAVATSILEEGPFEPMDGEGAKFLGAVP
IVEGEMGSRELAKNASAALKGSRACIVRGHGVFAVGSTLEEAYVVACMVEHSAMIRRLVS
VG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttggacccgaggaaagagatatcgaagtttggaagcaagatcgtctcgtccggcctgacc
tacgcccactttggaaacatcagcctcctatccgaggggatgatcctgatcacctccacc
ggatcgatcctcgacgagctgacggaggacgaggtgatcgccgtcaccccggaagccccc
tgccccgaggacgccctcgccagctgcgagacggtggtccaccgggccatctacgagaag
acgacggcccgggcggtgatccacacccactcgccttacgccgtcgccacctccatcctg
gaggaggggcccttcgagccgatggacggcgagggggcgaagttcctcggggcggtgccg
atcgtcgagggggagatggggagccgagagctcgcaaagaacgcctcggccgccctgaag
gggagcagagcctgcatcgtccgggggcacggggtcttcgccgtcggctcgaccctcgag
gaggcctacgtcgtcgcctgcatggtggagcacagcgccatgataagaaggctcgtcagc
gtcggatga

DBGET integrated database retrieval system