KEGG   Methanosaeta harundinacea: Mhar_0064Help
Entry
Mhar_0064         CDS       T01990                                 

Definition
Phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhar_0064
   01230 Biosynthesis of amino acids
    Mhar_0064
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_0064
  Energy metabolism
   00680 Methane metabolism
    Mhar_0064
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mhar_0064
Enzymes [BR:mhi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mhar_0064
Exosome [BR:mhi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mhar_0064
  Exosomal proteins of melanoma cells
   Mhar_0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
70347..71177
Genome map
AA seq 276 aa AA seqDB search
MGSEKDFFCPANGPPESGRPLPSARDRDSGGLRLRSDENLILLRHGQSVYNREKRFTGWA
DVPLSPTGEAEARRAGRLLRSQGLEYEIAFTSLLKRAIKTLWLVSEEMELEWVSAVKAVE
LNERHYGALQGRTRDEVAALAGEEQVRLWRRGFSERPPPLDYDDPRHPRFDRRYRFLAAD
RLPSAEALADVSDRIVPFWTDRIAPEVRSGRRVLVVSHGNALRALVKYLEGISDDGIAAV
EIPTGVPLVYHLGPDLRPRSRRLLFEEEGIADDRRY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtggggtcggaaaaggatttcttctgccccgccaacggccctcctgaatcgggccgaccc
ctcccttcggcccgagatcgagattccgggggccttcgattgagatcagatgagaacctc
atcctcctccgccacggccagtccgtctacaaccgcgagaaaaggttcaccggctgggcc
gacgtccccctctcgcccacgggcgaggcggaggcgcggcgggccggccggcttctccgc
tcgcaggggctggagtacgagatcgccttcacgtcgctcctcaagagggcgatcaagacc
ctctggctcgtctccgaggagatggagctggagtgggtttcggccgtcaaggcggtggag
ctgaacgagcgccactacggggcgctccagggccggaccagagacgaggtggcggccctg
gcaggagaggagcaggtccggctctggcggcgcggcttttcggagaggccgccgcccctg
gattacgacgatccccgccacccccgcttcgaccggcgctaccgcttcttggcggctgat
cggcttccttccgctgaggccctggccgacgtcagcgaccggatcgtccccttctggacc
gataggatcgcgcccgaggtgaggtccggccggagggtcctcgtcgtctcccacggaaac
gccctccgcgccctggtcaaatacctggaggggatcagcgacgacgggatcgccgccgtg
gagatcccgacgggagtacccctcgtctaccacctcggcccggatctccgcccccggtcc
cgccgcctcctcttcgaagaggagggaatcgcagatgatcgcagatactga

DBGET integrated database retrieval system