KEGG   Methanosaeta harundinacea: Mhar_0064Help
Entry
Mhar_0064         CDS       T01990                                 

Definition
Phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhar_0064
   01230 Biosynthesis of amino acids
    Mhar_0064
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_0064
  Energy metabolism
   00680 Methane metabolism
    Mhar_0064
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mhar_0064
Enzymes [BR:mhi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mhar_0064
Exosome [BR:mhi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mhar_0064
  Exosomal proteins of melanoma cells
   Mhar_0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
70347..71177
Genome map
AA seq 276 aa AA seqDB search
MGSEKDFFCPANGPPESGRPLPSARDRDSGGLRLRSDENLILLRHGQSVYNREKRFTGWA
DVPLSPTGEAEARRAGRLLRSQGLEYEIAFTSLLKRAIKTLWLVSEEMELEWVSAVKAVE
LNERHYGALQGRTRDEVAALAGEEQVRLWRRGFSERPPPLDYDDPRHPRFDRRYRFLAAD
RLPSAEALADVSDRIVPFWTDRIAPEVRSGRRVLVVSHGNALRALVKYLEGISDDGIAAV
EIPTGVPLVYHLGPDLRPRSRRLLFEEEGIADDRRY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtggggtcggaaaaggatttcttctgccccgccaacggccctcctgaatcgggccgaccc
ctcccttcggcccgagatcgagattccgggggccttcgattgagatcagatgagaacctc
atcctcctccgccacggccagtccgtctacaaccgcgagaaaaggttcaccggctgggcc
gacgtccccctctcgcccacgggcgaggcggaggcgcggcgggccggccggcttctccgc
tcgcaggggctggagtacgagatcgccttcacgtcgctcctcaagagggcgatcaagacc
ctctggctcgtctccgaggagatggagctggagtgggtttcggccgtcaaggcggtggag
ctgaacgagcgccactacggggcgctccagggccggaccagagacgaggtggcggccctg
gcaggagaggagcaggtccggctctggcggcgcggcttttcggagaggccgccgcccctg
gattacgacgatccccgccacccccgcttcgaccggcgctaccgcttcttggcggctgat
cggcttccttccgctgaggccctggccgacgtcagcgaccggatcgtccccttctggacc
gataggatcgcgcccgaggtgaggtccggccggagggtcctcgtcgtctcccacggaaac
gccctccgcgccctggtcaaatacctggaggggatcagcgacgacgggatcgccgccgtg
gagatcccgacgggagtacccctcgtctaccacctcggcccggatctccgcccccggtcc
cgccgcctcctcttcgaagaggagggaatcgcagatgatcgcagatactga

DBGET integrated database retrieval system