KEGG   Methanosaeta harundinacea: Mhar_0163Help
Entry
Mhar_0163         CDS       T01990                                 

Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mhi  Methanosaeta harundinacea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mhi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(177581..178540)
Genome map
AA seq 319 aa AA seqDB search
MRRMRRLRKPGLRRIVAETRVSADDLIMPLFVDERLKRPIKIESMPGQNRHSLESLAKEV
EELEELGVPAVILFGLPEKKDEVGSGAYDPQGVVQRAAERIKETTSKVIVIADLCLCEYT
SHGHCGLIKNQEVANDETLPLLGKAAVSQARAGADVVAPSGMMDHMVAAIRGALDDEGFT
DTPILSYAAKYASSFYGPFREAAESGYSFGDRSGYQMDPANALEALWEVRLDIEEGADMI
MVKPAMPYLDIVRMVKDEFGMPTAAYQVSGEYSMIMAAAERGWIDGEKAMGEALTSIKRA
GADMILTYYAKKFARKAHG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggatgcgtagacttcgtaagccggggctgagaaggatcgtcgccgagacgagg
gtctcggcggacgacctgatcatgcccctcttcgtggatgagcggttaaagaggcccatc
aagatcgagtcgatgccggggcagaataggcactccctcgagagcctcgcgaaggaggtc
gaggagctggaggagctgggggtccccgccgtcatcctattcggccttcctgaaaagaag
gacgaggtcggctccggcgcttacgatccccagggcgtcgtccagagggcggccgagcgg
atcaaggagacgacctcgaaggtcatcgtcatcgccgacctctgcctctgcgagtacacc
agccacggccactgcggcctgatcaaaaaccaggaggtggccaacgacgagaccctcccc
ctcctgggcaaagcagccgtctcccaggcgagggcgggagcggacgtcgtcgcccccagc
gggatgatggaccacatggtggccgcgatccgcggagccctggacgacgagggattcacc
gatacccccatcctctcctacgccgccaagtacgcctccagcttctacggacccttccgg
gaggcggcggagtcggggtactccttcggcgaccggtccggctaccagatggaccccgcc
aacgctttagaggcgctatgggaagtccgcctcgacatcgaggagggggcggatatgatc
atggtgaagccggcgatgccctacctcgacatcgtgaggatggtcaaagacgagttcggg
atgccgacggccgcctatcaggtgagcggtgagtactcgatgatcatggccgcggcggag
cggggctggatcgatggagagaaggcgatgggcgaggcgctcacctccatcaagcgggcc
ggggcggatatgatattgacgtactatgcgaagaagtttgcgaggaaggcgcacgggtga

DBGET integrated database retrieval system