KEGG   Methanosaeta harundinacea: Mhar_0163Help
Entry
Mhar_0163         CDS       T01990                                 

Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mhi  Methanosaeta harundinacea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mhar_0163
Enzymes [BR:mhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mhar_0163
Exosome [BR:mhi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mhar_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(177581..178540)
Genome map
AA seq 319 aa AA seqDB search
MRRMRRLRKPGLRRIVAETRVSADDLIMPLFVDERLKRPIKIESMPGQNRHSLESLAKEV
EELEELGVPAVILFGLPEKKDEVGSGAYDPQGVVQRAAERIKETTSKVIVIADLCLCEYT
SHGHCGLIKNQEVANDETLPLLGKAAVSQARAGADVVAPSGMMDHMVAAIRGALDDEGFT
DTPILSYAAKYASSFYGPFREAAESGYSFGDRSGYQMDPANALEALWEVRLDIEEGADMI
MVKPAMPYLDIVRMVKDEFGMPTAAYQVSGEYSMIMAAAERGWIDGEKAMGEALTSIKRA
GADMILTYYAKKFARKAHG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggatgcgtagacttcgtaagccggggctgagaaggatcgtcgccgagacgagg
gtctcggcggacgacctgatcatgcccctcttcgtggatgagcggttaaagaggcccatc
aagatcgagtcgatgccggggcagaataggcactccctcgagagcctcgcgaaggaggtc
gaggagctggaggagctgggggtccccgccgtcatcctattcggccttcctgaaaagaag
gacgaggtcggctccggcgcttacgatccccagggcgtcgtccagagggcggccgagcgg
atcaaggagacgacctcgaaggtcatcgtcatcgccgacctctgcctctgcgagtacacc
agccacggccactgcggcctgatcaaaaaccaggaggtggccaacgacgagaccctcccc
ctcctgggcaaagcagccgtctcccaggcgagggcgggagcggacgtcgtcgcccccagc
gggatgatggaccacatggtggccgcgatccgcggagccctggacgacgagggattcacc
gatacccccatcctctcctacgccgccaagtacgcctccagcttctacggacccttccgg
gaggcggcggagtcggggtactccttcggcgaccggtccggctaccagatggaccccgcc
aacgctttagaggcgctatgggaagtccgcctcgacatcgaggagggggcggatatgatc
atggtgaagccggcgatgccctacctcgacatcgtgaggatggtcaaagacgagttcggg
atgccgacggccgcctatcaggtgagcggtgagtactcgatgatcatggccgcggcggag
cggggctggatcgatggagagaaggcgatgggcgaggcgctcacctccatcaagcgggcc
ggggcggatatgatattgacgtactatgcgaagaagtttgcgaggaaggcgcacgggtga

DBGET integrated database retrieval system