KEGG   Methanosaeta harundinacea: Mhar_0585Help
Entry
Mhar_0585         CDS       T01990                                 

Definition
(GenBank) AMP-forming acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
mhi00010  Glycolysis / Gluconeogenesis
mhi00620  Pyruvate metabolism
mhi00640  Propanoate metabolism
mhi00680  Methane metabolism
mhi00720  Carbon fixation pathways in prokaryotes
mhi01100  Metabolic pathways
mhi01110  Biosynthesis of secondary metabolites
mhi01120  Microbial metabolism in diverse environments
mhi01130  Biosynthesis of antibiotics
mhi01200  Carbon metabolism
Module
mhi_M00357  Methanogenesis, acetate => methane
mhi_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_0585
   00620 Pyruvate metabolism
    Mhar_0585
   00640 Propanoate metabolism
    Mhar_0585
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mhar_0585
   00680 Methane metabolism
    Mhar_0585
Enzymes [BR:mhi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mhar_0585
Lipid biosynthesis proteins [BR:mhi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mhar_0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Fer4_7 Fer4 Fer4_21 Fer4_10 Fer4_9 Fer4_17 Fer4_2 Fer4_6 Fer4_8 Fer4_22 Fer4_4 Fer4_13 Fer4_16 Fer4_15
Motif
Other DBs
NCBI-ProteinID: AET63963
UniProt: G7WNI7
Position
complement(602522..604408)
Genome map
AA seq 628 aa AA seqDB search
MSSLLDRFVPRTDFKSYEDFIENFKIIVPKEFNFAFDVVDVYAEEDPHKVALVWCNDSGD
EKILTFGDMKRESDRAANFFKGHGIRKGDAVMLSLKSRYEFWISMIGLHKIGAVAIPATH
MLKRKDIVYRIRRADLKMIISIAEEGVPEEVDGACKELRDAGVLKAFVGEGARDGWLNLR
EELEAASPEFERPEGTKSSDILLAYFTSGTTGNPKMVNHDQSYSLGHILTARYWQNVEDG
GLHYTVADTGWGKAVWGKLYGQWIAGSAVFVYDYDRFDAGRMMDMAAKYRVTTFCAPPTI
YRFMIKEDISRYDFSTLRYAVTAGEPLNPSIYEKFLAATGLRLMEGFGQTETVVAIANYP
WMDPKPGSMGKPSPGYEIVLVDKNDRICEVGEEGEIVIKTDKGKPIGLFVDYHLDPEKMR
NTWHDDYYHTGDTAWMDEDGYFWFVGRADDIIKSSGYRVGPFEVESALLTHPAVLECAIT
GVPDPLRGQVVKATVVLTKGSAPSEELKNELQNHVKAITAPYKYPRIVEFAEELPKTISG
KIRRVEIREKDKPYPVINALECKACERCIIACPTNVLALGEELNARGYHYAIYSGEGCIG
CGNCYYTCPEPFAIEVHIPSKEKFEEEG
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctctactggataggttcgtccccaggacggatttcaaatcttatgaggatttt
atagagaacttcaagatcatagtccccaaggagttcaacttcgcctttgacgtcgtcgac
gtctacgccgaggaggacccccataaggtggccctcgtctggtgcaacgactccggggac
gagaagatcctgaccttcggggatatgaagcgcgagagcgacagggctgccaacttcttc
aaggggcacggcataaggaagggagacgccgtgatgctctccctcaagagccgatatgag
ttctggatctctatgatcggcctccacaagatcggggccgtcgccatccccgcaacccac
atgctgaagaggaaggatatcgtctataggatccggcgggcggacctgaagatgatcata
tccatcgccgaggagggggtccccgaggaggtggacggagcctgtaaggaattgagagat
gccggggtcctgaaggccttcgtcggagaaggggcgagggacggctggctgaacctgagg
gaggagctggaggcggcatccccggagttcgagaggccagaagggacgaagagctccgac
atcctcctcgcctacttcacctccgggacgacaggaaaccccaagatggtaaaccacgac
cagagctactccctcggccacatcttgacggcgaggtactggcagaacgtcgaggatggc
ggcctccactacaccgtcgccgacaccggctgggggaaggcagtctgggggaagctctac
ggccagtggatcgcgggatcggcggtcttcgtctacgactacgaccggttcgacgccggg
aggatgatggatatggcggctaagtacagagtcaccaccttctgcgccccccccaccatc
taccggttcatgataaaggaggacatctccaggtacgacttctcgaccctccggtacgcc
gtcaccgccggcgagcccctcaacccctcgatatacgaaaagttcctcgctgcgacgggg
ctgcggctgatggaggggttcggccagactgagacggtcgtcgccatagccaactacccc
tggatggacccgaagcccgggtcgatggggaagccctcccccggctacgagatcgtcctg
gtggacaagaacgacaggatctgcgaggtcggggaggagggggagatcgtcatcaagacg
gataagggcaagcccatcggcctcttcgtcgactaccacctcgaccccgagaagatgagg
aacacctggcacgacgactactaccacaccggggacaccgcctggatggacgaggacggc
tacttctggttcgtcggaagggccgacgacatcatcaagagctccggctatagggtcggc
cccttcgaggtggagagcgccctcctcacccaccccgcggtcctggagtgcgctatcacc
ggggtcccggaccccctccgggggcaggtggtgaaggcgacggtcgtcctgacgaaaggc
tctgcgccgtcggaggagctgaagaatgagctccaaaaccacgtcaaagctatcaccgcc
ccctacaagtacccgaggatcgtcgagttcgcagaagagctcccgaagacgatcagcggc
aagataaggagggttgagatcagggagaaggacaagccttatccggtgatcaacgccctg
gagtgcaaggcgtgcgagaggtgcatcatcgcctgccccaccaacgtcctcgccctggga
gaggagctgaacgctcggggataccattacgcgatctattcgggggaggggtgcatcggc
tgcgggaactgctactacacctgcccggagcccttcgccatcgaggtccacataccgtca
aaggagaagttcgaggaggagggatag

DBGET integrated database retrieval system