KEGG   Methanosaeta harundinacea: Mhar_0698Help
Entry
Mhar_0698         CDS       T01990                                 

Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mhi  Methanosaeta harundinacea
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mhar_0698
Enzymes [BR:mhi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mhar_0698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
737293..738159
Genome map
AA seq 288 aa AA seqDB search
MFNRSNFADADADPEVADFIIVGAPFDATTCFRSGTREGPEAVRRASYNFETYIHRYSID
FNDLLVADLGDLYLGADPADAMETIRESFGFIPEGATPIFIGGEHSITPSIVAEVARRRG
EIGVVVLDAHLDLRDEYGGTRYSHACASRRILEVEGVAGYASIGIRSGDLKEYLYAEERG
VSYHSSDEVRERGIEAVLEEALEEVGCDEIYLSIDFDAIDPAFAPGVGTPEPFGLSSWDV
RHIVEKVAPKAVGLDANEIAPQYDGGQTASLGAKLIREFIASKAAASR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacaggtccaattttgcggacgccgacgccgacccggaggtggcggatttcatc
atcgtaggggctcccttcgatgccaccacctgctttaggtccgggacccgcgaaggcccc
gaagccgtccggcgggcatcttacaacttcgagacttacattcaccgttactccatcgat
tttaacgacctcctggtcgccgacctcggggacctctacctgggggcggaccccgccgac
gccatggagacgatccgggagtccttcggcttcatccccgagggggcgacgccgatcttc
atcggcggagagcactccattacgccgtcgatcgtcgccgaggtggcccggaggcgcggc
gagatcggcgtcgtcgtcctcgacgcccacctcgacctccgggacgagtacggcgggacg
aggtacagccacgcctgcgccagccgccggatcctggaggtggagggggtagcaggctac
gcctccatcgggattcggtccggcgacctgaaggagtacctctacgccgaggagcggggc
gtcagctaccattccagcgacgaggtccgggagcgggggatcgaggcggtcctggaggag
gccctggaggaggtgggctgcgacgagatctacctctccatcgacttcgacgccatcgat
cccgccttcgctccgggggtcgggacccccgagcccttcggcctctcctcctgggacgtt
cggcacattgtcgagaaggtggcgccgaaggccgtaggcctggatgcaaacgagatcgcc
ccccagtacgacggggggcagaccgcctccctgggcgcgaagttgatccgggagttcatc
gcctcaaaggcggcggctagccggtag

DBGET integrated database retrieval system