KEGG   Methanosaeta harundinacea: Mhar_0876Help
Entry
Mhar_0876         CDS       T01990                                 

Definition
Histone acetyltransferase, ELP3 family protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mhi  Methanosaeta harundinacea
Brite
Enzymes [BR:mhi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Mhar_0876
Transfer RNA biogenesis [BR:mhi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Mhar_0876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
952855..954456
Genome map
AA seq 533 aa AA seqDB search
MKRDRGLKADRGVTEGLREIVDAILAGEIGSEAELDKWKRKAGRKFGLADLPKNADILAE
ADESERARLKLLVRKPTRTLSGVAVVAAMTSPAPCPHGVCVPCPGGIGLSSPTPQSYTGR
EPAAMRAIQQGYDPYLQVRARLRQLSEIGHPLDKVDLIIMGGTITSRPLGYASWFVKRCL
EAMNDHPQRGPGPGGSSLQEARKSFQEVALENESSRVRNVGTTFETRPDWCGPASIRSIL
HLGGTKVELGVQSTDDELLLRMRRGHTVRETIEANRALREAGLKVGFHMMPGLPGSDPQR
DLASFRELFDGEEFRPDYLKIYPALVVEGTELYDLYLRGEYEPLGDGEAAELISRIKELI
PPYTRLQRVQRDIPAPAIAAGVKKSNLRQLAKARLLSRGGSCRCIRCREAGLRGVSEEAE
VSLRDLSYRACGGEERFLSFEAEDGTLAGFLRLRLSEGAHVRELHVYGPMTPLGKRGGWQ
HRGIGSTLLAEAEEISSYRGYESLRVTSGIGARPYYRRQGYQLQGPYMVRDLP
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaagagggatcgggggctgaaagcggatcgaggtgtgacggagggcctccgggagatc
gtcgacgccatcctcgccggggagatcggaagcgaggcggagctcgataagtggaagagg
aaggccggccgcaagttcggcctcgcagacctgccgaagaacgccgatatcctcgccgag
gccgatgagagtgagcgtgcccggctaaagctcctggttagaaagccgactagaactcta
tcgggggtggcggtggtggcggcgatgacctctcccgccccctgcccccacggggtctgc
gtcccctgccccggcggcataggtctatcgagcccaacgcctcagagctacaccggtcgg
gagccggcggcgatgagggcgatccaacagggctacgacccctacctccaggtgagggcg
cgcctccggcagctatcggagatcggccaccctctggacaaggtggacctgatcatcatg
ggggggacgatcacctcgcgccccctggggtatgcgagctggtttgtcaaaaggtgtctt
gaggcgatgaacgatcatccccagaggggcccgggtcccgggggctcctccctccaggag
gcccgaaagagcttccaggaggtggccctcgagaacgagtcctcccgggtcagaaacgtc
gggaccaccttcgagacgaggcccgactggtgcggtcccgcctccatccggagtatcctc
cacctcggggggacgaaggtggagctgggggtccagtccaccgacgacgaacttctcttg
aggatgagacgggggcacaccgtccgggagacgatcgaggcgaaccgggccctccgggag
gcggggctgaaggtggggtttcacatgatgcctggcctccccggatctgacccccagcgg
gacctcgcctcctttcgtgagctattcgatggcgaggagttccggcccgactacctcaag
atctatcccgccctggtggtggaggggacggagctctacgacctctacctccggggcgag
tacgagcccctgggggacggcgaggcggcagagctgatatcgaggataaaggagctgatc
cccccctacaccaggctccagcgggtccagagggacatccccgcccccgcgatagccgcc
ggggtcaaaaagagcaacctccgccagctggcgaaggcgcggctcctatcgagggggggg
tcctgccggtgcatccgctgccgggaggcggggctccggggggtctctgaggaggcggag
gtatccctcagagacctctcctaccgggcttgcggcggcgaagagcggttcctctccttt
gaggcggaggacggcaccctggcgggcttcctccgcctccggctctcggagggggcacac
gtcagggagctccacgtctacggccccatgacccccctggggaagaggggcggctggcag
caccggggcataggatcgaccctcctcgccgaggcggaggagatctcctcctaccggggt
tatgaatccctccgggtaacgagcggtatcggggcgaggccttactaccggaggcaaggc
taccagctccagggcccatacatggtcagggacctcccctga

DBGET integrated database retrieval system