KEGG   Methanosaeta harundinacea: Mhar_0897Help
Entry
Mhar_0897         CDS       T01990                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mhi  Methanosaeta harundinacea
Pathway
mhi00010  Glycolysis / Gluconeogenesis
mhi00052  Galactose metabolism
mhi00500  Starch and sucrose metabolism
mhi00520  Amino sugar and nucleotide sugar metabolism
mhi00521  Streptomycin biosynthesis
mhi01100  Metabolic pathways
mhi01110  Biosynthesis of secondary metabolites
mhi01120  Microbial metabolism in diverse environments
mhi01130  Biosynthesis of antibiotics
mhi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_0897
   00052 Galactose metabolism
    Mhar_0897
   00500 Starch and sucrose metabolism
    Mhar_0897
   00520 Amino sugar and nucleotide sugar metabolism
    Mhar_0897
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mhar_0897
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Mhar_0897
Enzymes [BR:mhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mhar_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AET64268
UniProt: G7WLG5
Position
complement(979672..980745)
Genome map
AA seq 357 aa AA seqDB search
MTWMKSNGAIDEMKTRIHQPDFDVGQFEGFVLGGDVGGTNTNIAVAGVREGKATLLYSAH
FESRRLTSLAPAIREALDYGRVKYGIEVVRGVVGVAGPVTDPRKAKPTNLPWTVDAEEMR
REFGFEEFRIENDFQIIGRGIESLKETDLFSAKGGDPAFGDGRAVIGAGTGLGKAILVYD
GEKYRPVPSEGGHADFPIQDHFDLDLADFIRGGRDTPASYEDLLSGRGIEVIYDFLKGRR
GRTDLTAEIEEAEDKAAAISKQRKTDPLCRETFAVYARCFGRCAKNFVLEAVATGGLYIA
GGIAAKNREVFASTEFSTEFLNAEKQRHLLERTPVSVITNYDVSLYGACNAAVHPSD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
gtgacctggatgaagagcaacggggcgatagatgagatgaagacgaggatccaccagccg
gatttcgacgtaggtcagttcgaaggcttcgtcctcggcggggacgtcggagggacgaac
accaacatcgccgtcgccggggtgagggaggggaaggccaccctcctctactccgcccac
ttcgagagccgaaggctcacctccctcgcaccggcgatccgggaggccctcgattatggc
cgggtgaaatacgggattgaggtcgtccggggcgtcgtcggggttgcgggtcccgtcacc
gaccccagaaaggcgaagcctacgaacctcccctggacggtggacgccgaggagatgagg
agggagttcggctttgaggagttcaggatagagaacgactttcagatcatcggacggggg
atcgaatccctgaaggaaaccgacctcttctctgcgaaggggggcgatccggccttcggc
gacggacgggcggtgatcggcgccgggaccggcctcggcaaggcgatcctggtctatgac
ggcgaaaaatacagacctgtccccagcgaaggggggcacgcggactttccgatccaggat
catttcgacctcgacctcgccgatttcatccggggcgggagagatacccccgccagctac
gaggacctcctctcggggcgggggatcgaggtgatctacgattttctgaaggggaggcgc
ggtcggacggatctgaccgccgagatcgaggaggccgaggataaggccgccgccatctca
aagcagagaaagacagaccccctatgccgcgagaccttcgccgtctacgcgaggtgcttc
ggcaggtgcgccaagaacttcgtcctggaggcggtcgccaccggcggcctctacatcgcc
ggggggatcgccgccaaaaatagagaggtcttcgcgtcgacagagttctccaccgagttt
ctgaacgccgagaagcagcgccaccttctggagaggactccggttagtgtcatcacaaac
tatgacgtgagcctctatggggcctgcaacgctgctgttcacccatctgattga

DBGET integrated database retrieval system