KEGG   Methanosaeta harundinacea: Mhar_0897Help
Entry
Mhar_0897         CDS       T01990                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhar_0897
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_0897
   00052 Galactose metabolism
    Mhar_0897
   00500 Starch and sucrose metabolism
    Mhar_0897
   00520 Amino sugar and nucleotide sugar metabolism
    Mhar_0897
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mhar_0897
   00524 Butirosin and neomycin biosynthesis
    Mhar_0897
Enzymes [BR:mhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mhar_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(979672..980745)
Genome map
AA seq 357 aa AA seqDB search
MTWMKSNGAIDEMKTRIHQPDFDVGQFEGFVLGGDVGGTNTNIAVAGVREGKATLLYSAH
FESRRLTSLAPAIREALDYGRVKYGIEVVRGVVGVAGPVTDPRKAKPTNLPWTVDAEEMR
REFGFEEFRIENDFQIIGRGIESLKETDLFSAKGGDPAFGDGRAVIGAGTGLGKAILVYD
GEKYRPVPSEGGHADFPIQDHFDLDLADFIRGGRDTPASYEDLLSGRGIEVIYDFLKGRR
GRTDLTAEIEEAEDKAAAISKQRKTDPLCRETFAVYARCFGRCAKNFVLEAVATGGLYIA
GGIAAKNREVFASTEFSTEFLNAEKQRHLLERTPVSVITNYDVSLYGACNAAVHPSD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
gtgacctggatgaagagcaacggggcgatagatgagatgaagacgaggatccaccagccg
gatttcgacgtaggtcagttcgaaggcttcgtcctcggcggggacgtcggagggacgaac
accaacatcgccgtcgccggggtgagggaggggaaggccaccctcctctactccgcccac
ttcgagagccgaaggctcacctccctcgcaccggcgatccgggaggccctcgattatggc
cgggtgaaatacgggattgaggtcgtccggggcgtcgtcggggttgcgggtcccgtcacc
gaccccagaaaggcgaagcctacgaacctcccctggacggtggacgccgaggagatgagg
agggagttcggctttgaggagttcaggatagagaacgactttcagatcatcggacggggg
atcgaatccctgaaggaaaccgacctcttctctgcgaaggggggcgatccggccttcggc
gacggacgggcggtgatcggcgccgggaccggcctcggcaaggcgatcctggtctatgac
ggcgaaaaatacagacctgtccccagcgaaggggggcacgcggactttccgatccaggat
catttcgacctcgacctcgccgatttcatccggggcgggagagatacccccgccagctac
gaggacctcctctcggggcgggggatcgaggtgatctacgattttctgaaggggaggcgc
ggtcggacggatctgaccgccgagatcgaggaggccgaggataaggccgccgccatctca
aagcagagaaagacagaccccctatgccgcgagaccttcgccgtctacgcgaggtgcttc
ggcaggtgcgccaagaacttcgtcctggaggcggtcgccaccggcggcctctacatcgcc
ggggggatcgccgccaaaaatagagaggtcttcgcgtcgacagagttctccaccgagttt
ctgaacgccgagaagcagcgccaccttctggagaggactccggttagtgtcatcacaaac
tatgacgtgagcctctatggggcctgcaacgctgctgttcacccatctgattga

DBGET integrated database retrieval system