KEGG   Methanosaeta harundinacea: Mhar_1072Help
Entry
Mhar_1072         CDS       T01990                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mhar_1072
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mhar_1072
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mhar_1072
Enzymes [BR:mhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mhar_1072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1153941..1155296
Genome map
AA seq 451 aa AA seqDB search
MKKIQYYSTNGHPERLDFKEALLRGQAPDKGLYVPDSIPRIPKEELARFSGMEYPEIALS
VMRRYIGDLIPEDDLVAILKDAYDFPVPIEKVYDEKYVMRLDRGPTFSFKDFAARLMGRL
MQHFLKEEGRSMVILTATSGDTGSAVAHAFYGLDNIRVVVLFPEGEVTGRQRKQMTTLGK
NVHVMAVDGKFDDCQAMVKEAFVDPDFADLNLSSANSINIGRLIPQSIYYFYAWSRTAAP
DREVVFSVPCGNFGNVMAGLLAMRMDLPVHRFVIATNENDEFPRFLSTGDYRPIRPSVKC
ISNAMNVGHPSNLARIFWLYGGEMDETGRVVRAPQIEAMRRDIFAVSVTDAETRETISEA
YNRYDVLLEPHGAVGWAGLARYLKEVEDWRPSVSLETADPAKFPEEVVRAVGLEPPVPES
MARLDGMEERFDLIAGEYGSFKERLSELFRG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatccaatactacagcaccaacggccaccccgagcgcctcgacttcaaggag
gcgctcctccggggccaggcccccgacaaggggctctacgtccccgactcgatcccccgg
atcccaaaagaggagctcgcccgcttctcggggatggagtaccccgagatcgccctctcc
gtgatgcgccgctacatcggcgacctcatccccgaggatgacctcgtcgcaatcctgaaa
gatgcctacgactttcccgtccccatcgagaaggtctacgacgaaaagtacgtgatgcgc
ctcgaccgcggccccaccttctccttcaaggacttcgccgcccggctgatgggccggctg
atgcagcacttcctaaaagaggagggccgctcgatggtgatcctgacggcgacctccggg
gacacgggaagcgccgtcgcccacgccttctacggcctggataacatccgggtcgtggtc
ttgtttccggagggagaggtgaccggaaggcagagaaagcagatgaccaccctcggcaaa
aacgtccacgtgatggccgtcgacggcaagttcgatgactgccaggcgatggtgaaagag
gccttcgtcgaccccgacttcgctgacctcaatttgtcgtccgccaactccatcaacatc
ggccggttgattccgcaatcgatctactacttctacgcctggtcccggacagcggccccc
gaccgggaggtcgtcttctccgttccttgcggcaacttcggaaatgtcatggcggggctc
ctcgccatgaggatggatctacccgtccatcgtttcgtcatcgccaccaacgagaacgac
gagttcccccgtttcctctccaccggggactaccggccgatccggccctcggtcaagtgc
atctccaacgccatgaacgtcggccacccctccaacctcgcccggatcttctggctctat
ggcggagagatggacgagaccggccgggtcgtccgggcgccccagatcgaggcgatgagg
cgggatatattcgccgtctccgtcaccgacgccgagacgcgggagacgatctccgaggcg
tacaacaggtacgacgtcctcctggagccccacggcgccgtcggctgggcgggcctcgcc
cgctacctgaaggaggtcgaggactggaggccttccgtctccctggagaccgccgacccc
gccaagttccccgaggaggtggtccgggccgtcggcctcgagccgccggtgccagagagc
atggcccgcctcgacggcatggaggagaggttcgacctcatcgccggggagtacggctcc
ttcaaggagaggctctctgagctcttccggggatag

DBGET integrated database retrieval system