KEGG   Methanosaeta harundinacea: Mhar_1072Help
Entry
Mhar_1072         CDS       T01990                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mhi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mhi00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mhi00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1153941..1155296
Genome map
AA seq 451 aa AA seqDB search
MKKIQYYSTNGHPERLDFKEALLRGQAPDKGLYVPDSIPRIPKEELARFSGMEYPEIALS
VMRRYIGDLIPEDDLVAILKDAYDFPVPIEKVYDEKYVMRLDRGPTFSFKDFAARLMGRL
MQHFLKEEGRSMVILTATSGDTGSAVAHAFYGLDNIRVVVLFPEGEVTGRQRKQMTTLGK
NVHVMAVDGKFDDCQAMVKEAFVDPDFADLNLSSANSINIGRLIPQSIYYFYAWSRTAAP
DREVVFSVPCGNFGNVMAGLLAMRMDLPVHRFVIATNENDEFPRFLSTGDYRPIRPSVKC
ISNAMNVGHPSNLARIFWLYGGEMDETGRVVRAPQIEAMRRDIFAVSVTDAETRETISEA
YNRYDVLLEPHGAVGWAGLARYLKEVEDWRPSVSLETADPAKFPEEVVRAVGLEPPVPES
MARLDGMEERFDLIAGEYGSFKERLSELFRG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatccaatactacagcaccaacggccaccccgagcgcctcgacttcaaggag
gcgctcctccggggccaggcccccgacaaggggctctacgtccccgactcgatcccccgg
atcccaaaagaggagctcgcccgcttctcggggatggagtaccccgagatcgccctctcc
gtgatgcgccgctacatcggcgacctcatccccgaggatgacctcgtcgcaatcctgaaa
gatgcctacgactttcccgtccccatcgagaaggtctacgacgaaaagtacgtgatgcgc
ctcgaccgcggccccaccttctccttcaaggacttcgccgcccggctgatgggccggctg
atgcagcacttcctaaaagaggagggccgctcgatggtgatcctgacggcgacctccggg
gacacgggaagcgccgtcgcccacgccttctacggcctggataacatccgggtcgtggtc
ttgtttccggagggagaggtgaccggaaggcagagaaagcagatgaccaccctcggcaaa
aacgtccacgtgatggccgtcgacggcaagttcgatgactgccaggcgatggtgaaagag
gccttcgtcgaccccgacttcgctgacctcaatttgtcgtccgccaactccatcaacatc
ggccggttgattccgcaatcgatctactacttctacgcctggtcccggacagcggccccc
gaccgggaggtcgtcttctccgttccttgcggcaacttcggaaatgtcatggcggggctc
ctcgccatgaggatggatctacccgtccatcgtttcgtcatcgccaccaacgagaacgac
gagttcccccgtttcctctccaccggggactaccggccgatccggccctcggtcaagtgc
atctccaacgccatgaacgtcggccacccctccaacctcgcccggatcttctggctctat
ggcggagagatggacgagaccggccgggtcgtccgggcgccccagatcgaggcgatgagg
cgggatatattcgccgtctccgtcaccgacgccgagacgcgggagacgatctccgaggcg
tacaacaggtacgacgtcctcctggagccccacggcgccgtcggctgggcgggcctcgcc
cgctacctgaaggaggtcgaggactggaggccttccgtctccctggagaccgccgacccc
gccaagttccccgaggaggtggtccgggccgtcggcctcgagccgccggtgccagagagc
atggcccgcctcgacggcatggaggagaggttcgacctcatcgccggggagtacggctcc
ttcaaggagaggctctctgagctcttccggggatag

DBGET integrated database retrieval system