KEGG   Methanosaeta harundinacea: Mhar_1075Help
Entry
Mhar_1075         CDS       T01990                                 

Definition
(RefSeq) Triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhar_1075
   01230 Biosynthesis of amino acids
    Mhar_1075
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_1075
   00051 Fructose and mannose metabolism
    Mhar_1075
   00562 Inositol phosphate metabolism
    Mhar_1075
Enzymes [BR:mhi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mhar_1075
Exosome [BR:mhi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mhar_1075
  Exosomal proteins of bladder cancer cells
   Mhar_1075
  Exosomal proteins of melanoma cells
   Mhar_1075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1157149..1157937
Genome map
AA seq 262 aa AA seqDB search
MVDEDHSRPSKNLAPIDGDQAARSSKLAVGHRRLRPSVMIMTKVVLNFKTYSEATGAEAL
KLSRICEEAKDQYDVEIAVAVQAPDIRLISENVSIPVYAQHVDGVGFGGFTGSITAAAVK
AAGATGTLINHSERRLRLAEIEASISACRAAGISAIVCTNNVPTTRAAASLKPDYVAVEP
PELIGSGIPVSKADPGIVTGSVEAVKRIEPSVGVLCGAGISRGEDLRAALDLGSEGVLLA
SGIVKAKDQKAALEDLLSGIRR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggtggatgaggatcattcccggccgtcgaagaatctagcgccgatcgatggcgatcaa
gcggcccgatcctcgaagctggccgttgggcatcgacgattgcggccttcggtgatgatc
atgacaaaggttgtgcttaacttcaagacctactcggaggctacgggggctgaggccctg
aagctctcccggatttgtgaggaggcaaaagatcagtacgacgtcgagatcgccgtggcg
gttcaggccccggatatccggctgatatcggagaacgtatcgatacccgtctacgcccag
cacgtcgacggggtcgggttcggcggcttcaccggctccatcaccgccgccgccgtcaag
gctgcgggagccaccgggaccctcataaaccattcggagaggaggctccggctcgccgag
atcgaggcctctatttcggcctgccgggccgccgggatctccgccatagtctgcaccaac
aacgtccccaccacccgggccgccgcctccctcaagcccgattacgtggcggtggagccc
cccgagctgatcggtagcggcatccccgtctccaaggccgaccccggcattgtaacgggg
tcggtagaggcggtgaagaggatcgagccctccgtcggggttctctgtggagccgggatc
agccggggcgaggacctccgggcggccctcgatctcgggtcggagggggtcctcctcgcc
tcggggatcgtcaaggcgaaggatcagaaggcggccctggaggacctcctctccgggatc
cggaggtga

DBGET integrated database retrieval system