KEGG   Methanosaeta harundinacea: Mhar_1075Help
Entry
Mhar_1075         CDS       T01990                                 

Definition
Triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhar_1075
   01230 Biosynthesis of amino acids
    Mhar_1075
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_1075
   00051 Fructose and mannose metabolism
    Mhar_1075
   00562 Inositol phosphate metabolism
    Mhar_1075
Enzymes [BR:mhi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mhar_1075
Exosome [BR:mhi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mhar_1075
  Exosomal proteins of bladder cancer cells
   Mhar_1075
  Exosomal proteins of melanoma cells
   Mhar_1075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1157149..1157937
Genome map
AA seq 262 aa AA seqDB search
MVDEDHSRPSKNLAPIDGDQAARSSKLAVGHRRLRPSVMIMTKVVLNFKTYSEATGAEAL
KLSRICEEAKDQYDVEIAVAVQAPDIRLISENVSIPVYAQHVDGVGFGGFTGSITAAAVK
AAGATGTLINHSERRLRLAEIEASISACRAAGISAIVCTNNVPTTRAAASLKPDYVAVEP
PELIGSGIPVSKADPGIVTGSVEAVKRIEPSVGVLCGAGISRGEDLRAALDLGSEGVLLA
SGIVKAKDQKAALEDLLSGIRR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggtggatgaggatcattcccggccgtcgaagaatctagcgccgatcgatggcgatcaa
gcggcccgatcctcgaagctggccgttgggcatcgacgattgcggccttcggtgatgatc
atgacaaaggttgtgcttaacttcaagacctactcggaggctacgggggctgaggccctg
aagctctcccggatttgtgaggaggcaaaagatcagtacgacgtcgagatcgccgtggcg
gttcaggccccggatatccggctgatatcggagaacgtatcgatacccgtctacgcccag
cacgtcgacggggtcgggttcggcggcttcaccggctccatcaccgccgccgccgtcaag
gctgcgggagccaccgggaccctcataaaccattcggagaggaggctccggctcgccgag
atcgaggcctctatttcggcctgccgggccgccgggatctccgccatagtctgcaccaac
aacgtccccaccacccgggccgccgcctccctcaagcccgattacgtggcggtggagccc
cccgagctgatcggtagcggcatccccgtctccaaggccgaccccggcattgtaacgggg
tcggtagaggcggtgaagaggatcgagccctccgtcggggttctctgtggagccgggatc
agccggggcgaggacctccgggcggccctcgatctcgggtcggagggggtcctcctcgcc
tcggggatcgtcaaggcgaaggatcagaaggcggccctggaggacctcctctccgggatc
cggaggtga

DBGET integrated database retrieval system