KEGG   Methanosaeta harundinacea: Mhar_1075Help
Entry
Mhar_1075         CDS       T01990                                 

Definition
Triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mhi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mhi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mhi00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mhi00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mhi00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1157149..1157937
Genome map
AA seq 262 aa AA seqDB search
MVDEDHSRPSKNLAPIDGDQAARSSKLAVGHRRLRPSVMIMTKVVLNFKTYSEATGAEAL
KLSRICEEAKDQYDVEIAVAVQAPDIRLISENVSIPVYAQHVDGVGFGGFTGSITAAAVK
AAGATGTLINHSERRLRLAEIEASISACRAAGISAIVCTNNVPTTRAAASLKPDYVAVEP
PELIGSGIPVSKADPGIVTGSVEAVKRIEPSVGVLCGAGISRGEDLRAALDLGSEGVLLA
SGIVKAKDQKAALEDLLSGIRR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggtggatgaggatcattcccggccgtcgaagaatctagcgccgatcgatggcgatcaa
gcggcccgatcctcgaagctggccgttgggcatcgacgattgcggccttcggtgatgatc
atgacaaaggttgtgcttaacttcaagacctactcggaggctacgggggctgaggccctg
aagctctcccggatttgtgaggaggcaaaagatcagtacgacgtcgagatcgccgtggcg
gttcaggccccggatatccggctgatatcggagaacgtatcgatacccgtctacgcccag
cacgtcgacggggtcgggttcggcggcttcaccggctccatcaccgccgccgccgtcaag
gctgcgggagccaccgggaccctcataaaccattcggagaggaggctccggctcgccgag
atcgaggcctctatttcggcctgccgggccgccgggatctccgccatagtctgcaccaac
aacgtccccaccacccgggccgccgcctccctcaagcccgattacgtggcggtggagccc
cccgagctgatcggtagcggcatccccgtctccaaggccgaccccggcattgtaacgggg
tcggtagaggcggtgaagaggatcgagccctccgtcggggttctctgtggagccgggatc
agccggggcgaggacctccgggcggccctcgatctcgggtcggagggggtcctcctcgcc
tcggggatcgtcaaggcgaaggatcagaaggcggccctggaggacctcctctccgggatc
cggaggtga

DBGET integrated database retrieval system