KEGG   Methanosaeta harundinacea: Mhar_1184Help
Entry
Mhar_1184         CDS       T01990                                 

Definition
F420-0:gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mhi  Methanosaeta harundinacea
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mhi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1277924..1278667
Genome map
AA seq 247 aa AA seqDB search
MDPVCCHLVRGLPAIKEGDDLAAMIRERFAVQDGDVVCIASTVVSKAEGRARRLEDYSPS
PRAEEIAGRLEKDPRFVQAVLEEAEEVLLDHPFLLVATRFGHIGVNAGIDRSNVGEGRIL
LLPVDPGASAEEIRRRLGRDCAVIVTDTCGRPFRCGVAGVAIGWAGIAALRDWRGERDLE
GRELEITLEAIADEVAGMANLLMGEAGDGTPAAVLRGLALPKAGWRLFRPRELDVIRARL
RDRDSGI
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggacccggtctgctgccatctggtgaggggccttcccgcgataaaggagggggacgac
ctcgcagcgatgatcagggagcggtttgccgtccaggacggcgacgtcgtctgcatcgcc
tccaccgtcgtctccaaggcggaagggcgggcgaggaggctcgaggactactccccctcc
cccagggccgaggagatcgccggaaggctggagaaggatccgaggttcgtccaggcggtc
ctggaggaggcggaggaggttcttttagatcaccccttcctcctggtggcgacgaggttc
ggccacatcggggtcaacgccggcatagatagatcgaacgtcggcgaggggaggatccta
ctcctcccggtggaccccggagccagcgccgaggagatccgccgccgcctcggtagggac
tgcgccgtcatcgtcaccgacacctgcggaaggcccttccgctgcggcgtcgcgggcgtc
gccatcggctgggccgggatcgcggccctgcgggactggcggggggagcgggacctggag
gggagggagctggagataaccctggaggcgatcgccgacgaggtcgccgggatggcgaac
ctcctgatgggggaggcgggggacggaacccccgccgccgtcctccgggggctcgccctc
ccgaaggctgggtggaggctcttccggccgcgggagctggacgtgatccgggcccggctc
cgggatcgggattccgggatctag

DBGET integrated database retrieval system