KEGG   Methanosaeta harundinacea: Mhar_1291Help
Entry
Mhar_1291         CDS       T01990                                 

Definition
AMP-forming acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhar_1291
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_1291
   00620 Pyruvate metabolism
    Mhar_1291
   00640 Propanoate metabolism
    Mhar_1291
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mhar_1291
   00680 Methane metabolism
    Mhar_1291
Enzymes [BR:mhi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mhar_1291
Lipid biosynthesis proteins [BR:mhi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mhar_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1391008..1392690
Genome map
AA seq 560 aa AA seqDB search
MSSLVSRFVSGTEFEAYEEFKNNMKINVPERFNFAFDVVDVYAEMAPDKKALVWCNDRGD
ELILTFGELKRRSDQAANLFKKCGIRKGDSVMLTLKGRYDFWICMVGLHKVGAVAIPATH
MLRAKDIAYRISKADLKMIVSIAEDGVPDEVDGACRDLEGAKPVRALVGDGVDRPGWLDF
RRELAAASPEFERPPGREATENGDVLLAYFTSGTTGYPKMVKHDQTYPLGHILTAKFWQN
VVEDGLHYTVADTGWAKCVWGQIYGQWIAGSGVFAYDYDRFDAGRMMEMATKHGVTTFCA
PPTIYRFMIKGDMSRYDFSSLKYAVTAGEPLNPTVYDLFFEATGLRLMEGYGQTETVVAI
ANFPMMNPKPGSMGKPSPGYDIVLVDKDDRICDVGEEGEIVIRTDEGKPPGLFIDYHLDP
DRMRNTWHDDYYHTGDTAWMDEDGYLWFIGRTDDMIKSSGYRVGPFEVENALMSHPAVME
CAVTGVADPLRGQVVKATVVLTKGHTPSEELEVELQNHVKKVTAPYKYPRIIEFVEALPK
TISGKIRRIEIRERDETRGG
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcattggtttccaggttcgtatcagggacggaattcgaggcttacgaagaattt
aaaaataatatgaagataaatgtgccggagaggttcaacttcgccttcgacgtggtggac
gtctacgccgaaatggcacctgataaaaaagccctcgtctggtgcaacgaccggggcgac
gagcttatcctcaccttcggggagctgaagcggaggagcgaccaggcggcaaacttattt
aaaaagtgcggcataagaaagggggactcggtcatgctgaccctgaaggggcggtacgac
ttctggatatgcatggtggggctccataaggtaggggcggtggcgatcccggcgacccac
atgttgagggcgaaggacatcgcctatcggatcagcaaggcggacctcaagatgatcgtc
tccatcgcagaggacggcgtccccgacgaggtcgacggagcctgccgggatctcgagggg
gcgaagcccgtcagggccctagtcggcgacggcgtcgataggcccggctggctcgacttc
cgccgggagctggcggcggcttcgccggagtttgagcggcccccggggcgagaggcgacg
gagaacggggacgtcctcctcgcctacttcacctccgggaccaccggctaccccaagatg
gtgaagcacgaccagacatatcccctgggccacatcctgacggcgaagttctggcagaac
gtcgtcgaggacggcctccactacaccgtcgccgacaccggctgggcgaagtgcgtctgg
ggccagatctacggccagtggatcgcgggctcgggggtcttcgcctacgactacgacagg
ttcgacgccggcaggatgatggagatggcgaccaagcatggtgtcaccaccttctgcgcc
ccgccgacgatctatcgtttcatgatcaagggggatatgtcgaggtacgacttctcctcc
ctcaagtacgccgtcaccgccggcgagcccctcaaccccaccgtctacgacctattcttc
gaggcgacggggctgcggctgatggaggggtacggccagacggagacggtcgtggccatc
gccaactttccgatgatgaacccgaagcccggatcgatggggaagccgtcgcccggttac
gacatagtcctcgtcgacaaggacgaccggatctgcgatgtgggggaggagggggagatc
gtcatcaggaccgacgagggaaagcccccggggctctttatcgactaccacctcgacccc
gataggatgagaaacacctggcacgacgactactatcataccggggacaccgcctggatg
gacgaggacggctacctctggttcatcgggaggaccgacgacatgatcaagagctccggc
tatcgggtcggccccttcgaggtggagaacgccctcatgtcccacccggcggtgatggag
tgcgccgtcaccggcgtcgccgaccccctccggggacaggtggtgaaggcgacggtcgtc
ctgacgaagggtcacaccccatcggaggagctggaggtcgagctccaaaaccacgtcaag
aaggtgaccgccccctacaagtaccctcggatcatagagttcgtggaggccctccccaag
acgatcagcggcaagataagaaggatcgagatcagggagagggacgagacgaggggcgga
tga

DBGET integrated database retrieval system