KEGG   Methanosaeta harundinacea: Mhar_1434Help
Entry
Mhar_1434         CDS       T01990                                 

Definition
Protoporphyrin IX magnesium-chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mhar_1434
Enzymes [BR:mhi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mhar_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1540724..1541995)
Genome map
AA seq 423 aa AA seqDB search
MKILRITGVIRERGSSPGSASEAGSGGAPDSISDPTMRGSSAKNERRGRGGRDPAASKAP
DRSGWPESTAAESGTSGSFALHLARSKRLLYPFAAIVGQEKMKRALILNAINPSIGGVLI
RGEKGTAKSTAVRGLAEVLPEIEVVVGCRFGCDPRDGEKLCWECAERLAEGVLPTELRPM
RVVDLPVGATEDRVVGSLDMERALRGGERAFEPGVLAEANRGILYVDEINLLDDYVVDAL
LDAAAMGMNVVEREGVSASHPASFIIVGSMNPEEGELRPQLLDRIALQVEVEGISDVEQR
VEIIERSNAFSEDPAKFREGFEAENRKLTSRIVAAKKALPRVAVGRGELRNIARIAIEFG
VDGHRADIMIERTARANAAFEGRERVEAADIVAAAEMVLPHRMRKTPFDEGDYSPERLRS
LVG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatattgaggatcactggcgtcataagggaaaggggctcttcccccgggtcggcc
tccgaggccggctccggcggggctccggactcgatctcggaccccacgatgagaggatct
tcggctaagaacgagagaaggggcagaggcgggcgggatccggccgcttcgaaggccccg
gacagatcgggctggcccgaatcaacggccgcagaaagcgggacgtccggatccttcgcc
ctccacctggcgaggtcgaagaggctcctctaccccttcgccgccatcgtcggccaggag
aagatgaagcgggccctgatcctcaacgccatcaacccctcgattgggggggtcctgatc
cggggagagaaggggacagcgaagtcgacggccgtccggggtctcgccgaggtcctgccg
gagatcgaggtggtggtgggctgcaggttcggctgcgatccccgggatggggagaagctc
tgctgggagtgcgccgagcggctggcggagggggttttgccgacggagttgaggccgatg
cgggtcgtcgacctccccgtcggggcgacggaggaccgggtggtggggtccctggacatg
gagcgggccctccgggggggggagagggcctttgagcccggggtcctggcggaggcgaac
cgtggcatcctctacgtcgacgagatcaacctcctcgacgactacgtcgtcgacgccctc
ctcgacgccgccgccatggggatgaacgtcgtcgagcgggagggggtcagcgccagccac
cccgcgagcttcatcatcgtcgggtcgatgaacccggaggagggggagctccgtccccag
cttctggacaggatcgccctccaggtggaggtggagggaatatccgacgtcgagcagcgg
gtggagatcatcgagaggagcaacgccttctccgaggatcccgccaagttcagggagggg
tttgaggccgagaataggaaactcacatcccggatcgtcgccgccaagaaggccctcccc
agggtcgccgtcgggaggggcgagctccgaaatatagccagaatagccatcgagtttggg
gtcgacggccatcgggccgacatcatgatcgagcggacggcgagggctaacgccgccttc
gaggggagggagcgggtcgaggccgccgacatcgtcgccgcggcggagatggtgctgcct
cacaggatgaggaagacccccttcgacgaaggcgattacagccccgagaggctccgatcg
ctggtgggctga

DBGET integrated database retrieval system