KEGG   Methanosaeta harundinacea: Mhar_1615Help
Entry
Mhar_1615         CDS       T01990                                 

Definition
Magnesium-chelatase subunit ChlD
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mhar_1615
Enzymes [BR:mhi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mhar_1615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1737353..1739398
Genome map
AA seq 681 aa AA seqDB search
MHHLKRRTLPFTSIVGQEEMKFALILNAINPRIGGVLIRGDKGTAKSTAVRALAELLADI
PVVEGCPFNCNPYNPEEMCDLCQERGENLKVASRRTPVVDLPLGSTEDRVVGSLDVERAI
KEGIKALDPGILAAANRGILYIDEVNLLDDHVADVLLDSAAMGVNVVEREGISVAHPAKF
ILVGTMNPEEGELRPQLLDRFGLQVNVESIDDVDMRMEIVKAAEEFERDPEGFAEGARVH
QEDLRLRIMDAKEILSDALLGDDLLRAMASACIDLGVKSHRAEIVITRTAKTIAAFEGRT
WVEQRDVERAMKLALPHRMRSKPFEPPSLNEERLKESIQRHQPKKETESNEPEEKSAPQQ
ERPQTDQEESEGSRREQRPREEKVFDIGDPIDPRRMEMPRRRDGVARRKSGGRRMNSLSL
RNSGRYLHSRLSKGGMDIAVDATIRAAAPHQKGRRGANAVNVRGEDFREKERVRKVSAVV
LFVVDASGSMGSVRRMESAKGAILSMLMDSYQKRDKVGMVAFRKGEAEVLLPPSSSVDLA
MKRLRELPTGGKTPLSSGIAKGLRALQAEIKKDSETKPIMVLISDGRANVSTGGNIKEEL
MAISEQARMSGVHTIVVDTEVVESSFMEIRLGYCREIAVASGGRYHRISSLSSDAIFEIV
DREEKLLFEANTLIDASNAHF
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgcaccatttaaagagaaggactcttccatttacttccatagtaggccaagaggagatg
aaattcgccctcatcctcaacgccataaacccccggataggcggggtgctcataaggggg
gataaggggacggcgaagtcgacggcagtaagggccctggcagaacttctagcagatatc
cctgtggtggagggctgccccttcaactgcaatccttacaacccggaggagatgtgcgac
ctgtgccaagagaggggggagaatctgaaggtcgcctccaggaggactcccgtcgtcgac
ctgcccctggggtccaccgaggacagggtggtggggtccctggacgtcgagagggcgata
aaggaggggatcaaggccctggatcccggtatcctggcagcggcaaaccgggggatcctc
tacatcgacgaggtgaacctcctcgatgatcacgtcgccgacgtcctcctggactcggcc
gccatgggggtcaacgtcgtcgagagggaggggatctccgtcgcccaccccgccaagttc
atcttggtggggacgatgaatccggaggagggggagctgcggccacaattgctggacagg
ttcggcctccaggtcaacgtcgagagcatcgacgacgtcgacatgaggatggagattgtg
aaggccgccgaggagtttgaacgggaccctgaaggctttgccgagggggcgagggtccat
caggaggatctacgcctgaggataatggatgcaaaagagatcctgagcgacgcccttctc
ggcgacgacctcctcagggcgatggcctccgcctgcatagatctgggggtgaagagccac
agggccgagatagtcataaccaggaccgcaaagacgatcgcagctttcgaggggaggact
tgggtggaacagagggatgtggagagggcgatgaagttagcccttccccatcggatgagg
tcgaagccctttgagcccccatccctgaatgaggagaggctcaaggagtccatccaaaga
caccagccgaagaaagagacggagagtaacgagcccgaagaaaagagcgcgcctcagcaa
gaaaggccccagaccgaccaggaggagagcgaggggagcaggagagagcaacggcccaga
gaggagaaggtctttgatatcggcgaccccatagacccgagaaggatggagatgccccgc
cgaagggacggagtcgccaggagaaagtccgggggcaggagaatgaactccttatccctc
cgaaactcgggaaggtatcttcactccagactctccaagggggggatggacatagctgtc
gatgccacgatcagggccgcagccccccaccagaaaggccgccgcggggccaacgccgtc
aacgtacggggagaagatttccgggagaaggagagggtcagaaaggtctctgccgtcgtc
ctcttcgtggtggatgcgagcggatcgatgggatcggtgaggaggatggaatcggcgaag
ggtgccatcctatcgatgttgatggactcctatcagaagagggataaggtggggatggtc
gccttcaggaagggggaggcggaagtcttgctacccccctcctccagcgtcgatctggcg
atgaagaggcttcgagagcttcccaccggagggaaaacgcccctctcttcggggatagcc
aagggtctgagagccctccaggcggagatcaaaaaggactcagagacgaagccgataatg
gttctgatatcggacggcagagcgaacgtctccacggggggtaatataaaagaagagctg
atggcaatctccgagcaggcccggatgagcggcgttcacaccatagtggtggatacggag
gtggtggagagttcctttatggagattaggcttgggtactgccgtgagatagcggtggcc
tcaggaggacgttaccatcggatatcaagcctcagctccgatgccatattcgagatagtg
gatcgggaagagaagctcctcttcgaggccaacaccttaatcgatgcttctaatgcccat
ttttga

DBGET integrated database retrieval system