KEGG   Methanosaeta harundinacea: Mhar_1625Help
Entry
Mhar_1625         CDS       T01990                                 

Definition
Putative thymidine phosphorylase
Orthology
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
mhi  Methanosaeta harundinacea
Brite
Enzymes [BR:mhi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Mhar_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1746603..1748147
Genome map
AA seq 514 aa AA seqDB search
MKLKTIFLGLEAGGRSVVIMNGDDAERLGVLALGRVTVRLDGIVKTAIVNTSTEMIEPGR
IGVCKRVWEGLGLADGSEVEVEVAPFPDSIYFIRNKLDGRKLAFDEVLEIVEDTVAERLS
DVEITAFVTALHSFGLDLDEATNLSLAMIKTGRTMKLDGGPIVDKHSIGGVPGDKTTLLV
VPLVAAAGLLIPKSSSRAITSPAGTADRAEVLMPVGLDLEEMRSVVEEAGGCIVWGGSVH
LAPADDIFVRVEYPLSIDPLLLPSIISKKRAVGADLLVVDIPTGRGAKVKTIGEANLLAK
DFMEIGSRLGIRVQGAVTYGEQPIGRAIGPALEAKEAMEVLMNRPGPRDVAEKATAIAGI
LLEMAGREDGKALAEELLRSGKAEQKMREIIEAQGGDPEVLPEDIAVGDHKFTVRSDRSG
HLLWINNSSIAEVARFAGCPKDEGAGILLARKIGDAVEEGDPLFTIFAERGNNLQRALDR
LEGLRVVGVGDGMEMLIHEVKERPVAKRSFTLDR
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaaaaacgatcttcctggggctggaggcgggcggcagatcggtcgtcatcatg
aacggagacgacgccgagcggctgggggtcctggccctggggagggtgaccgtccggctc
gacggaattgtgaagaccgccatcgtcaacacctccacggagatgatagagccgggccgg
attggcgtctgcaaacgggtctgggaggggctcggcctcgccgacggctccgaggtcgag
gtggaggtggcacccttccccgactcgatctacttcataagaaacaagctggacgggagg
aagctcgccttcgacgaggtcctggagatcgtcgaggatacggtggcggagaggctgagc
gacgtcgagatcaccgccttcgtcaccgccctccacagcttcggcctcgacctcgacgag
gcgacgaacctctccctcgccatgatcaagacggggaggacgatgaagctcgacggaggg
ccgatcgtcgacaagcactccataggcggggtccctggggacaagacgaccctcctcgtc
gtacccctcgtggcggcagcggggctcttgataccgaaatcctcttcccgggccatcacc
tccccggcggggacggcggaccgggcggaggtcctgatgccggtgggcctcgacctcgag
gagatgcggtcggtggtggaggaggccggaggctgcatcgtctggggtggctccgtccac
ctggcgccggccgacgacatcttcgtcagggtcgagtaccccctctccatcgaccccctc
ctcttgccgtcgatcatctccaagaagagggccgtcggcgccgacctcctcgtcgtcgac
atccccaccggcaggggggccaaggtgaagacgatcggggaggcgaacctcctggccaag
gacttcatggagatcggaagccgcctggggatcagggtccagggcgccgtcacctacggc
gagcagcccatcggccgcgccataggaccagccctggaggcgaaagaggcgatggaggtt
ctcatgaaccgacctggacctcgggacgtggcggagaaggcgacggccatcgccgggatc
ctgctggagatggcagggagagaagacggcaaggccctggcggaggagctcctccggtcc
gggaaggcggagcagaagatgagggagatcatcgaggcccaggggggagatccggaggtc
ctgccggaggatatagccgtcggagaccacaagttcaccgtccgatccgataggtccggc
cacctcctctggataaacaactcgtcgatcgccgaggtggcgaggtttgcaggctgcccc
aaggacgagggagcagggatcctcctcgctaggaagatcggggatgccgtcgaggagggg
gaccccctcttcaccatcttcgccgagaggggcaacaacctccagcgggccctggatagg
ctggaggggctgagggtggtgggcgtcggagatgggatggagatgctgatccacgaggtg
aaggagaggccggtggcgaagaggagcttcaccctggatagatga

DBGET integrated database retrieval system