KEGG   Methanosaeta harundinacea: Mhar_1888Help
Entry
Mhar_1888         CDS       T01990                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mhi  Methanosaeta harundinacea
Brite
Enzymes [BR:mhi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mhar_1888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2045747..2046349
Genome map
AA seq 200 aa AA seqDB search
MLRGRVSDRVLEAMEDTPRELFVPNRVRQMAYQDHPLPIGDGQTISAPHMVAIMCDLLDL
GEGMRVLDVGTGSGYHAAVMAKLVGPEGHVYSIERVATLVAFARKNLSEAGIENVTVVEG
DGSRGLPDHAPFDRINVAATAPKVPEPLQAQLKVGGKLVIPVGTCYQELLLVVRTEEGFE
MEQHGGVVFVPLIGDHGFQV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgctccgggggagggtcagcgaccgggtcctggaggcgatggaagatacgccccgggag
ctcttcgtccccaatcgggtgcggcagatggcttaccaggaccaccccctccccatcggc
gacggccagacgatatccgccccccacatggtggcgatcatgtgcgacctcctcgacctc
ggagaggggatgagggtcctggacgtggggaccggctccggctaccacgccgcggtgatg
gcgaagctggtggggcccgaaggccacgtctactccatcgagcgggtggcaacgctcgtc
gccttcgcccggaagaacctctcggaggcggggatcgagaacgtcaccgtcgtcgagggg
gatgggagccgcggcctccccgaccacgcccccttcgaccggatcaacgtcgcggcgacg
gcgccgaaggtccccgagcccctccaggcccagctgaaggtggggggaaagctcgtcatc
cccgtggggacctgctaccaggagctcctcctggtcgtcaggaccgaggaggggtttgag
atggagcagcacggcggcgtcgtcttcgtccccctgatcggcgaccacggctttcaggtc
tag

DBGET integrated database retrieval system