KEGG   Methanosaeta harundinacea: Mhar_1975Help
Entry
Mhar_1975         CDS       T01990                                 

Definition
Tryptophan synthase, alpha subunit
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mhi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mhi00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mhi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2128561..2129346)
Genome map
AA seq 261 aa AA seqDB search
MRLAEAFRRRPLLIAYICAGDPSPEATVEVAELLARAGADVVELGLPHSDPIADGPVIQA
AAQRAIEAGMNTDVYFETASRIRAKIPLVFMGYYNMIYQRGLEKFAGDCGASGITGLIVP
DLPPEEAGPLRAACRRADLDLISLIAPNTPAERIPLIAENSSGFLYLVARAGVTGARSEV
LQSTKALIERVNSELPRAVGFGISTPEQAAEVIRAGADAAIVGSACVDLISKGDLAGLEE
LIRGMKAAIGEARPIEAAARI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcgccgaggccttcaggcgccgccccctcctcatcgcctacatctgcgccggc
gaccccagccccgaggcgacggtggaggtggcggagctcctcgcccgggccggggccgac
gtcgtcgagctggggctcccccactctgacccgatagccgacggccccgtcatccaggcg
gcggcccagagggcgatcgaggcggggatgaacaccgacgtatacttcgagactgcctcc
cggatcagggcgaagatccccctggtcttcatgggctactacaacatgatctaccagcgg
gggcttgagaagttcgccggcgactgcggggcgagcggcatcaccggcctcatcgtcccc
gaccttccgccggaggaggcgggccccttgcgggcggcctgcaggagggcggacctcgac
ctgatatccctcatcgccccgaataccccggcggagaggatccccctcatcgcagaaaat
tccagtggcttcctctacctcgtcgcccgggcgggggtgacgggggccaggtccgaggtg
ctgcagtcgacgaaggccctcatcgagcgggtgaactccgagctgcccagggccgtcggc
ttcggcatctcaaccccggagcaggcggcggaggtgatccgggccggagccgacgccgcc
atcgtcggatccgcctgcgtcgacctgatctcgaagggcgaccttgcggggctggaggag
ctgatccgcgggatgaaggcggcgatcggagaggcgcggccgatcgaggcggcggcgagg
atctga

DBGET integrated database retrieval system