KEGG   Methanosaeta harundinacea: Mhar_1976Help
Entry
Mhar_1976         CDS       T01990                                 

Definition
(GenBank) Tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mhar_1976
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mhar_1976
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mhar_1976
Enzymes [BR:mhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mhar_1976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2129343..2130560)
Genome map
AA seq 405 aa AA seqDB search
MGADEDLMKTKDAPTTRFGRFGGQFVPETLIQPLKELAEAYLRLKEDADFMGELNSLLAD
YAGRPTPLYLARALSRELGQKVYLKREDLVHGGAHKLNNVLGQALVAKAIGKTRLIAETG
AGQHGVASAMVGANLGLETEVYMGEVDIERQKMNVYRMELLGARVIPVRSGSRTLKDAIN
EAMRDWAGSYETTHYLMGTVAGPHPYPLMVRELQSVIGTEAREQILAAEGRLPDAVAACV
GGGSNAMGIFSGFLKDETRLIAVEAGGRGITSGRKIADHGACLNFGDEGVLHGAMTKILQ
DPYGQILESYSLAAGLDYPGVGPELAHLAEVGRVTPAVADDETALLGLRRLSVLEGIIPA
LESSHAVGYALRNPDALGEVSIINLSGRGDKDLATVMEHEGRVGR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgatgaagatttgatgaagaccaaagatgcgccgacgacgaggtttgggagg
ttcggaggacagttcgtccccgagaccctgatccagcccctgaaggagctggcagaggct
taccttcgcctcaaggaggacgccgatttcatgggagagctcaattcccttctggccgac
tacgccggaaggcccacccccctctacctcgcccgggccctctcccgggagctgggccag
aaggtctacctgaagagggaggacctggtccacggaggggcccataagctgaacaacgtc
ctggggcaggccctggtggccaaggcgatcggaaagacgaggctcatcgccgagacgggg
gcggggcagcacggcgtcgcctccgccatggtgggggcgaacctcggcctcgagacggag
gtctacatgggggaggtggacatcgagcggcagaagatgaacgtctaccggatggagctg
ttgggggcgagggtgataccggtgaggtcggggtcgaggaccctcaaggacgccatcaac
gaggcgatgagggactgggctgggagctacgagacgacccactacctgatggggacggtc
gccgggccccacccctaccccctgatggtgagggagcttcagtccgtcatcgggaccgag
gcgagggagcagatcctagccgccgaggggaggctccccgatgccgtcgccgcctgcgtc
ggcggaggctccaacgccatggggatcttctccggctttcttaaggatgagacgaggctg
atcgccgtcgaggcgggggggagggggatcacctccggccgaaagatagcagaccacggc
gcctgcctcaacttcggggacgagggggtcctccacggggcgatgaccaagatcctccag
gacccctacggccagatcctcgagtcctactccctggccgcaggcctcgactaccccggc
gtcggccccgagctcgcccacctcgccgaggtcggcagggtgacgccggcggtggccgac
gacgagaccgccctcctcggcctgaggcggctctcggtcctggaggggatcattccagcg
ctcgagtcctctcacgccgtcggctacgccctaagaaaccccgatgccctcggggaggtc
tcgatcatcaacctctcaggaaggggagataaggacctggcgacggtgatggagcatgag
gggagggtggggagatga

DBGET integrated database retrieval system