KEGG   Methanosaeta harundinacea: Mhar_2004Help
Entry
Mhar_2004         CDS       T01990                                 

Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mhi  Methanosaeta harundinacea
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mhar_2004
Enzymes [BR:mhi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Mhar_2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2162700..2163929
Genome map
AA seq 409 aa AA seqDB search
MTIEGFIGKIRVGDLHPVRVMGVINLSRESFYEESYAGIDAVLGRALAFAEEGAEVLDLG
AVSTAPGSPSIPEEEERRRLFPALEAVLDGLGEEVVVSVDTQRASVADDALSAGAGCIND
VSGLHDPAMAKTVADHDGSLIIMASKERPGDILDMRDIVANLGERVRAAWEAGVAAEKVT
VDPGIGRWTPPKGPGHDLAILDGLERLRVLKRPVMAAVSRKSFIGAVLERPSPSDRLPGS
LAAAAVAVYNGAHLVRTHDVAASLDVIRMAEAVRGRPAIAGAGGIEVEVFGHWGHPEDLH
QAFAGLGVGEGGAKALGGKGSFRALSLRGVTSPEAVVIKQEMLARGGDAAIPTGALRCDP
GEMEVLVLGTAAQLRGLVKDLIDQPFRLPTISGAIEEALDRLEDPKRYW
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatcgaggggttcatcggcaagatcagagtgggagacctccaccccgtccgggtg
atgggggtgatcaacctcagccgggagtcgttctacgaggagtcttacgccggcatcgac
gccgtcctggggcgggccctcgccttcgccgaggagggggcggaggtcctggacctgggg
gcggtctcgacggcgccggggtcgccctcgatccccgaggaggaggagcgaagaaggctc
tttcccgccctggaggcggtcctggacggcctcggcgaggaggtcgtcgtctccgtcgac
acccagagagcatcggtcgccgacgatgctctatccgccggggcgggttgcataaacgac
gtctcggggctccacgaccccgccatggcaaagaccgtggccgaccacgacgggtccctc
atcatcatggcgtcgaaggagaggcccggcgacatcctcgatatgagggatatcgtggcc
aacctcggcgagagggtgagggccgcctgggaggccggcgtagcagccgagaaggtgacc
gtcgatccggggatcggccggtggacgccgccgaagggaccagggcacgacctcgccatc
ctggacggcctcgaacggctgagggtcctgaagaggccggtgatggcggcggtctcgagg
aagtccttcatcggggcggtcctggaacggcctagcccctcagaccggctgccggggagc
ctcgccgccgccgccgtcgccgtctacaacggcgcccacctcgtccggacccacgatgta
gcggcttccctcgacgtcatccggatggcggaggcggtccggggacgcccagccatcgcc
ggcgccggggggatcgaggtggaggtcttcggccattggggccatcccgaggacctccac
caggcctttgccgggcttggggtgggggaaggaggggcgaaggccctcggaggcaagggc
tccttccgggccctgtccctgcggggcgtcacctctccggaggcggtggtgatcaagcag
gagatgctggcccggggcggcgacgccgcgatacccacgggcgccctccggtgcgacccg
ggggagatggaggtcctggtcctggggacggcagcccagctccgggggctggtaaaagac
ctgatcgaccagcccttcaggctcccgacgatatctggcgccatcgaggaggcgctggac
cggctggaggatccaaaacgatattggtga

DBGET integrated database retrieval system