KEGG   Methanosaeta harundinacea: Mhar_2047Help
Entry
Mhar_2047         CDS       T01990                                 

Definition
Peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mhi  Methanosaeta harundinacea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mhi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2212657..2213730
Genome map
AA seq 357 aa AA seqDB search
MDGMKEMDEIQRLLERLSNAHGISGREGSIQEILREEMGHLVDDVRIDNLGNLVATRRGR
RPSVMIAAHIDEIGLMTKYVDEKGFIRFVTIGGWFDQTLLNQRVIIHADSGPIWGVIGSK
PPHVMTPEDRKKPIEVKDMFVDAGCESQEEALGLGIKPGTPMSIDRTFARLAGDRVTGKA
FDNRAGVVMMIEALKRTRTESTIFAVGTVQEEVGLKGARTSAFGLSPDVALATDVTIPGD
HPGIDKKDSPLEIGKGPVVIIADASGRGIITTSKVVSWLAETAKEFEIPVQMEVSGGGTT
DATAIQLTREGIHTGVISVATRYIHSPVEVLSLKDVDACAELIARALETAERYFKPD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggacgggatgaaagagatggacgagattcaaaggcttcttgaacggctgagcaacgcc
cacgggatatcgggacgggagggatcgatccaggagatcctccgggaggagatgggacac
ctcgtcgacgatgtgaggatcgacaacctcggaaacctcgtcgccaccagaaggggaagg
cggccgtcggtgatgatcgcagcccacatcgacgagatcggcctcatgaccaagtacgta
gacgagaaggggttcatccggttcgtcaccatcggaggctggttcgaccagaccctcctc
aaccagagggtgatcatccacgccgattccgggccgatatggggcgtcatcgggtcgaag
cccccccacgtcatgacccccgaagatcggaagaagccgatcgaggtgaaggatatgttc
gtcgacgccggctgcgaaagccaggaggaggccttggggcttgggatcaagcccggaacc
cccatgagcatcgatcggaccttcgccaggctcgccggggacagggtgacggggaaggcc
ttcgacaaccgcgccggtgtggtcatgatgatcgaggccctcaagaggacgaggacggag
tcgacgatcttcgccgtggggacggtccaggaggaggtggggctgaagggggcgaggacc
tccgccttcggcctctctcccgacgtcgctctcgcaacggacgtcaccatcccaggagac
catccggggatcgacaagaaggattcgcccctcgagataggaaagggtccggtggtgatc
atcgccgacgcctcagggcgggggatcatcaccacctcgaaggtcgtatcctggctcgcc
gagacggcgaaggagttcgagatccccgtccagatggaggtctccggcggcggcaccacc
gacgccacggcgatccagctcacccgggaggggatccatacgggggtgatcagcgtcgcc
acccgttacatccactcccccgtcgaggtcctgagcctgaaggacgtcgatgcctgcgcc
gagctgatcgcccgggccctggagacggcggagaggtacttcaagcccgattga

DBGET integrated database retrieval system