KEGG   Methanosaeta harundinacea: Mhar_2201Help
Entry
Mhar_2201         CDS       T01990                                 

Definition
(GenBank) 6-phosphofructokinase, putative
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mhi  Methanosaeta harundinacea
Pathway
mhi00010  Glycolysis / Gluconeogenesis
mhi00030  Pentose phosphate pathway
mhi00051  Fructose and mannose metabolism
mhi00052  Galactose metabolism
mhi00680  Methane metabolism
mhi01100  Metabolic pathways
mhi01110  Biosynthesis of secondary metabolites
mhi01120  Microbial metabolism in diverse environments
mhi01130  Biosynthesis of antibiotics
mhi01200  Carbon metabolism
mhi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_2201
   00030 Pentose phosphate pathway
    Mhar_2201
   00051 Fructose and mannose metabolism
    Mhar_2201
   00052 Galactose metabolism
    Mhar_2201
  Energy metabolism
   00680 Methane metabolism
    Mhar_2201
Enzymes [BR:mhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mhar_2201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AET65553
UniProt: G7WR92
Position
complement(2364114..2365070)
Genome map
AA seq 318 aa AA seqDB search
MILRIIMKAIVSLAINPTIDKSSSVEFVVPGRKLRCTAPTIEPGGGGVNVSRAVRKLGGE
STLLYAAGGLNGDLLEELLAGEGLRSRRLPLAGMTRESFAVLEESTGQQYRFGMPGPVLK
EEEVQLALEEVAASSPDSGFLVASGSLPPGVPADFYARVARAGKGAGAKVIVDTSGEPLK
RALQEGVYLIKPNLREFRELVDGDLRDEAEIEAAARKVVAGGGCELLVISLGSAGALFVS
REAVAHMRPPTVRIVSKVGAGDSMVAGITLSLARGMAPRDAALFGIAAGAAAVMTPGSEL
CRKEDAERLYRKLRADRD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgatccttcggatcatcatgaaagcaatcgtctctttagccatcaacccgacgatcgac
aagagctccagcgtcgagttcgtcgtccccgggaggaagctccgctgcaccgcccccacc
atcgagccgggcgggggcggggtgaacgtctcccgggcggtcaggaagctcgggggcgag
tcgaccctcctctacgccgccggggggctcaacggcgacctcctcgaggagctcctggcg
ggggaggggctccggagccggcggctccccctggcggggatgacccgggagagcttcgcc
gtcctggaggagtcgacggggcagcagtacaggttcgggatgccggggccggtgctgaag
gaggaggaggtgcagctcgccctggaggaggtcgccgcctcctccccggactccggcttc
ctcgtcgccagcgggagccttcccccgggggtcccggctgacttctacgcccgggtcgcc
cgggccgggaagggggcgggggcgaaggtgatcgtcgacacctccggcgagcccctgaag
agggccctccaggagggggtctacctgataaagccgaacctccgggagttccgggagctg
gtggacggggacctgagggatgaggcggagatcgaggcggcggcccggaaggtggtggcc
ggcggcggctgcgagctcctcgtcatctccctgggctctgcaggagctctattcgtcagc
cgggaggcggtcgcccacatgaggccgccgacggtcaggatcgtcagcaaggtgggggcg
ggcgacagcatggtggcggggatcaccctcagcctcgcccgggggatggcgccccgggac
gcggccctcttcgggatcgccgccggggccgccgccgtcatgacccccggctcggagctc
tgccgaaaggaggacgcagagcggctctacaggaagctccgagcggatcgcgactga

DBGET integrated database retrieval system