KEGG   Methanosaeta harundinacea: Mhar_2201Help
Entry
Mhar_2201         CDS       T01990                                 

Definition
6-phosphofructokinase, putative
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhar_2201
   01230 Biosynthesis of amino acids
    Mhar_2201
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_2201
   00030 Pentose phosphate pathway
    Mhar_2201
   00051 Fructose and mannose metabolism
    Mhar_2201
   00052 Galactose metabolism
    Mhar_2201
  Energy metabolism
   00680 Methane metabolism
    Mhar_2201
Enzymes [BR:mhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mhar_2201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2364114..2365070)
Genome map
AA seq 318 aa AA seqDB search
MILRIIMKAIVSLAINPTIDKSSSVEFVVPGRKLRCTAPTIEPGGGGVNVSRAVRKLGGE
STLLYAAGGLNGDLLEELLAGEGLRSRRLPLAGMTRESFAVLEESTGQQYRFGMPGPVLK
EEEVQLALEEVAASSPDSGFLVASGSLPPGVPADFYARVARAGKGAGAKVIVDTSGEPLK
RALQEGVYLIKPNLREFRELVDGDLRDEAEIEAAARKVVAGGGCELLVISLGSAGALFVS
REAVAHMRPPTVRIVSKVGAGDSMVAGITLSLARGMAPRDAALFGIAAGAAAVMTPGSEL
CRKEDAERLYRKLRADRD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgatccttcggatcatcatgaaagcaatcgtctctttagccatcaacccgacgatcgac
aagagctccagcgtcgagttcgtcgtccccgggaggaagctccgctgcaccgcccccacc
atcgagccgggcgggggcggggtgaacgtctcccgggcggtcaggaagctcgggggcgag
tcgaccctcctctacgccgccggggggctcaacggcgacctcctcgaggagctcctggcg
ggggaggggctccggagccggcggctccccctggcggggatgacccgggagagcttcgcc
gtcctggaggagtcgacggggcagcagtacaggttcgggatgccggggccggtgctgaag
gaggaggaggtgcagctcgccctggaggaggtcgccgcctcctccccggactccggcttc
ctcgtcgccagcgggagccttcccccgggggtcccggctgacttctacgcccgggtcgcc
cgggccgggaagggggcgggggcgaaggtgatcgtcgacacctccggcgagcccctgaag
agggccctccaggagggggtctacctgataaagccgaacctccgggagttccgggagctg
gtggacggggacctgagggatgaggcggagatcgaggcggcggcccggaaggtggtggcc
ggcggcggctgcgagctcctcgtcatctccctgggctctgcaggagctctattcgtcagc
cgggaggcggtcgcccacatgaggccgccgacggtcaggatcgtcagcaaggtgggggcg
ggcgacagcatggtggcggggatcaccctcagcctcgcccgggggatggcgccccgggac
gcggccctcttcgggatcgccgccggggccgccgccgtcatgacccccggctcggagctc
tgccgaaaggaggacgcagagcggctctacaggaagctccgagcggatcgcgactga

DBGET integrated database retrieval system