KEGG   Methanosaeta harundinacea: Mhar_2217Help
Entry
Mhar_2217         CDS       T01990                                 

Definition
(RefSeq) Pyruvate:ferredoxin oxidoreductase subunit A
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mhi  Methanosaeta harundinacea
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mhar_2217
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mhar_2217
   00020 Citrate cycle (TCA cycle)
    Mhar_2217
   00620 Pyruvate metabolism
    Mhar_2217
   00640 Propanoate metabolism
    Mhar_2217
   00650 Butanoate metabolism
    Mhar_2217
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mhar_2217
   00680 Methane metabolism
    Mhar_2217
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mhar_2217
Enzymes [BR:mhi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mhar_2217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2382024..2383202)
Genome map
AA seq 392 aa AA seqDB search
MKKVVEGSYGIADAVRCCSPDVISVYPITPQTHIVEHLSEFVADGKLDCQYINVESEFSS
LSSLIGASAAGARTYTSTTSQGLALMFEVLFNVSGMRLPIVMTTVNRALSAPLSIWNDQQ
DAMAAREAGWIQIYAENVQEAMDLTPQLYKISEDPKILTPSMACMDGFILTHVYEPVEFL
DIEKVREFLPPYRPEDVLDPKDPKTFGAFADPSWFTEFKYLQYQAMERAKKKIALVSKEF
EEVFGRGYGGLIDTYSMEDAEVALVTMGSVVGTVKEAIDGLRSEGVKVGLVKIRSYRPFP
EEELKEALKDAEVIVTIEKDVSMGYESALLTDLKGAFYNSPIRVPIVGFAAGLGGRDIGV
KQIRRIVERASKVRGAGIEAEFEIFDVKPECL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtggtagaaggatcctatgggatagccgatgccgtccggtgctgctctccc
gacgtcatatcggtctatccgatcaccccccagacccacatcgtcgagcacctctcggag
ttcgtcgccgacggaaagctcgactgccagtacatcaacgtcgagtcggagttctcctcc
ctctcctccctcatcggggcgtccgccgctggagcccgaacctacacctcgaccacctcc
caggggctcgccctgatgttcgaggtcctcttcaacgtctcggggatgaggcttcccatc
gtcatgacgacggtgaaccgggccctcagcgcccccctctccatctggaacgatcagcag
gacgccatggccgcccgggaggcgggctggatccagatctacgccgagaacgtccaggag
gcgatggacctcaccccccagctctacaagatctccgaggacccgaagatcctcaccccc
tccatggcctgcatggacgggttcatcctcacccacgtctacgagccggtggagtttttg
gatatcgagaaggtcagagagttcctcccgccctatcggcccgaggacgtcctcgacccg
aaagaccccaagaccttcggagccttcgccgacccgagctggtttacagagttcaagtac
ctccagtaccaggcgatggagagggctaaaaagaagatcgctctggtctcaaaggagttt
gaggaggtcttcggccgcggatacggcggcctcatcgatacctactccatggaggatgcc
gaggtcgccctcgtcaccatgggctccgtcgtcgggaccgtcaaggaggcgatcgacggc
ctcaggtccgagggggtgaaggtgggcctcgtcaagatcaggagctaccggcccttcccc
gaggaggagctgaaggaggccctgaaggatgcagaggtcatagtgacgatcgaaaaggat
gtatcgatggggtacgagagcgccctcctcaccgacctcaagggagccttctacaacagc
cccatcagggtgccgatcgtcgggtttgcggcaggcctcggcggccgggacatcggggtc
aagcagataagaaggatcgtcgagagggcgtcgaaggtcagaggcgccgggatcgaggcc
gagtttgagatcttcgacgtgaagccagagtgtctctag

DBGET integrated database retrieval system